You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
MRGPRD
Mas-related G-protein coupled receptor member D

Protein Summary
Description
May regulate nociceptor function and/or development, including the sensation or modulation of pain. Functions as a specific membrane receptor for beta-alanine. Beta-alanine at micromolar doses specifically evoked Ca(2+) influx in cells expressing the receptor. Beta-alanine decreases forskolin-stimulated cAMP production in cells expressing the receptor, suggesting that the receptor couples with G-protein G(q) and G(i).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000309106
  • ENSP00000310631
  • ENSG00000172938

Symbol
  • MRGD
  • MRGD
  • TGR7
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.67
cell line
0.64
protein domain
0.58
metabolite
0.45
tissue sample
0.4


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 50.53   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 97   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 50.53   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 97   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (1)
1 – 1 of 1
&beta;-alanine
chemical structure image
Gene Ontology Terms (5)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (27)
1 – 10 of 27
NPFF
Tbio
Novelty: 0.00350925
Score: 0.754
Data Source: STRINGDB
TRPV1
Tclin
Family: IC
Novelty: 0.00052256
Score: 0.71
Data Source: STRINGDB
TRPA1
Tclin
Family: IC
Novelty: 0.00104738
Score: 0.68
Data Source: STRINGDB
TRPM8
Tclin
Family: IC
Novelty: 0.00200706
Score: 0.654
Data Source: STRINGDB
P2RX3
Tchem
Family: IC
Novelty: 0.00216381
Score: 0.65
Data Source: STRINGDB
SCN10A
Tclin
Family: IC
Novelty: 0.00156461
Score: 0.583
Data Source: STRINGDB
PIEZO2
Tbio
Family: IC
Novelty: 0.00432783
Score: 0.573
Data Source: STRINGDB
FAM19A4
Tbio
Novelty: 0.04762169
Score: 0.565
Data Source: STRINGDB
NPS
Tbio
Novelty: 0.00011983
Score: 0.54
Data Source: STRINGDB
SLC17A8
Tbio
Family: Transporter
Novelty: 0.00915373
Score: 0.54
Data Source: STRINGDB
Publication Statistics
PubMed Score  50.53

PubMed score by year
PubTator Score  14.77

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MNQTLNSSGTVESALNYSRGSTVHTAYLVLSSLAMFTCLCGMAGNSMVIWLLGFRMHRNPFCIYILNLAA
1-70
ADLLFLFSMASTLSLETQPLVNTTDKVHELMKRLMYFAYTVGLSLLTAISTQRCLSVLFPIWFKCHRPRH
70-140
LSAWVCGLLWTLCLLMNGLTSSFCSKFLKFNEDRCFRVDMVQAALIMGVLTPVMTLSSLTLFVWVRRSSQ
140-210
QWRRQPTRLFVVVLASVLVFLICSLPLSIYWFVLYWLSLPPEMQVLCFSLSRLSSSVSSSANPVIYFLVG
210-280
SRRSHRLPTRSLGTVLQQALREEPELEGGETPTVGTNEMGA
280-321
MNQTLNSSGTVESALNYSRGSTVHTAYLVLSSLAMFTCLCGMAGNSMVIWLLGFRMHRNPFCIYILNLAAADLLFLFSMASTLSLETQPLVNTTDKVHELMKRLMYFAYTVGLSLLTAISTQRCLSVLFPIWFKCHRPRHLSAWVCGLLWTLCLLMNGLTSSFCSKFLKFNEDRCFRVDMVQAALIMGVLTPVMTLSSLTLFVWVRRSSQQWRRQPTRLFVVVLASVLVFLICSLPLSIYWFVLYWLSLPPEMQVLCFSLSRLSSSVSSSANPVIYFLVGSRRSHRLPTRSLGTVLQQALREEPELEGGETPTVGTNEMGA