You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
MYOZ3
Myozenin-3

Protein Summary
Description
Myozenins may serve as intracellular binding proteins involved in linking Z line proteins such as alpha-actinin, gamma-filamin, TCAP/telethonin, LDB3/ZASP and localizing calcineurin signaling to the sarcomere. Plays an important role in the modulation of calcineurin signaling. May play a role in myofibrillogenesis. The protein encoded by this gene is specifically expressed in the skeletal muscle, and belongs to the myozenin family. Members of this family function as calcineurin-interacting proteins that help tether calcineurin to the sarcomere of cardiac and skeletal muscle. They play an important role in modulation of calcineurin signaling. [provided by RefSeq, Apr 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000297130
  • ENSP00000297130
  • ENSG00000164591
  • ENST00000517768
  • ENSP00000428815
  • ENST00000615557
  • ENSP00000478375

Symbol
  • FRP3
  • CS3
  • CS-3
  • FRP3
  • FATZ-3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
0.65
small molecule perturbation
0.64
tissue sample
0.59
cell line
0.52
microRNA
0.49


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.06   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 25   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.06   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 25   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (5)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (21)
1 – 10 of 21
LDB3
Tbio
Novelty: 0.00093894
Score: 0.872
Data Source: STRINGDB
FLNC
Tbio
Novelty: 0.00112022
Score: 0.816
Data Source: STRINGDB
ACTN2
Tbio
Novelty: 0.00993205
Score: 0.815
Data Source: STRINGDB
TCAP
Tbio
Novelty: 0.00664743
Score: 0.781
Data Source: STRINGDB
ACTN1
Tbio
Novelty: 0.01041776
Score: 0.77
Data Source: STRINGDB
SYNPO
Tbio
Novelty: 0.00583594
Score: 0.647
Data Source: STRINGDB
MAPKAPK3
Tchem
Family: Kinase
Novelty: 0.01845634
Score: 0.595
Data Source: STRINGDB
MYOT
Tbio
Novelty: 0.01053217
Score: 0.53
Data Source: STRINGDB
RBM22
Tbio
Novelty: 0.09993655
Score: 0.501
Data Source: STRINGDB
MYBPC2
Tbio
Novelty: 0.44152431
Score: 0.497
Data Source: STRINGDB
Publication Statistics
PubMed Score  3.06

PubMed score by year
PubTator Score  128.75

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MIPKEQKGPVMAAMGDLTEPVPTLDLGKKLSVPQDLMMEELSLRNNRGSLLFQKRQRRVQKFTFELAASQ
1-70
RAMLAGSARRKVTGTAESGTVANANGPEGPNYRSELHIFPASPGASLGGPEGAHPAAAPAGCVPSPSALA
70-140
PGYAEPLKGVPPEKFNHTAISKGYRCPWQEFVSYRDYQSDGRSHTPSPNDYRNFNKTPVPFGGPLVGGTF
140-210
PRPGTPFIPEPLSGLELLRLRPSFNRVAQGWVRNLPESEEL
210-251
MIPKEQKGPVMAAMGDLTEPVPTLDLGKKLSVPQDLMMEELSLRNNRGSLLFQKRQRRVQKFTFELAASQRAMLAGSARRKVTGTAESGTVANANGPEGPNYRSELHIFPASPGASLGGPEGAHPAAAPAGCVPSPSALAPGYAEPLKGVPPEKFNHTAISKGYRCPWQEFVSYRDYQSDGRSHTPSPNDYRNFNKTPVPFGGPLVGGTFPRPGTPFIPEPLSGLELLRLRPSFNRVAQGWVRNLPESEEL