You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
CERK
Ceramide kinase

Protein Summary
Description
Catalyzes specifically the phosphorylation of ceramide to form ceramide 1-phosphate. Acts efficiently on natural and analog ceramides (C6, C8, C16 ceramides, and C8-dihydroceramide), to a lesser extent on C2-ceramide and C6-dihydroceramide, but not on other lipids, such as various sphingosines. Binds phosphoinositides. CERK converts ceramide to ceramide 1-phosphate (C1P), a sphingolipid metabolite. Both CERK and C1P have been implicated in various cellular processes, including proliferation, apoptosis, phagocytosis, and inflammation (Kim et al., 2006 [PubMed 16488390]).[supplied by OMIM, Mar 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000216264
  • ENSP00000216264
  • ENSG00000100422

Symbol
  • KIAA1646
  • LK4
  • hCERK
  • dA59H18.2
  • dA59H18.3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.98
molecular function
0.96
virus perturbation
0.95
transcription factor perturbation
0.91
transcription factor binding site profile
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 87.78   (req: < 5)
Gene RIFs: 21   (req: <= 3)
Antibodies: 293   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 87.78   (req: >= 5)
Gene RIFs: 21   (req: > 3)
Antibodies: 293   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (1)
1 – 1 of 1
NVP 231
chemical structure image
Pathways (62)
Glycosphingolipid metabolism (R-HSA-1660662)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Glycosphingolipid metabolism
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Sphingolipid metabolism
Name
Explore in Pharos
Explore in Source
Glycosphingolipid metabolism
Metabolism
Metabolism of lipids
Sphingolipid metabolism
Protein-Protein Interactions (90)
1 – 10 of 90
PDCD2
Tbio
Novelty: 0.05415706
p_int: 0.999973464
p_ni: 0.000026524
p_wrong: 1.2e-8
Data Source: BioPlex
GMNN
Tbio
Novelty: 0.00563598
p_int: 0.999607641
p_ni: 0.00039235
p_wrong: 9e-9
Data Source: BioPlex
KCTD17
Tbio
Novelty: 0.20322581
p_int: 0.999491937
p_ni: 0.000508063
Score: 0.153
Data Source: BioPlex,STRINGDB
CCNDBP1
Tbio
Novelty: 0.02585442
p_int: 0.999392091
p_ni: 0.000605688
p_wrong: 0.000002221
Score: 0.177
Data Source: BioPlex,STRINGDB
TNFRSF9
Tbio
Novelty: 0.00148448
p_int: 0.996073064
p_ni: 0.003814281
p_wrong: 0.000112655
Score: 0.261
Data Source: BioPlex,STRINGDB
VWCE
Tbio
Novelty: 0.10129635
p_int: 0.993913181
p_ni: 0.005564123
p_wrong: 0.000522696
Data Source: BioPlex
HEPACAM2
Tbio
Novelty: 0.13703845
p_int: 0.992706426
p_ni: 0.006073343
p_wrong: 0.001220231
Data Source: BioPlex
HAVCR2
Tbio
Novelty: 0.00217571
p_int: 0.989670341
p_ni: 0.010307763
p_wrong: 0.000021896
Data Source: BioPlex
CD83
Tbio
Novelty: 0.00171116
p_int: 0.975386702
p_ni: 0.023241376
p_wrong: 0.001371922
Data Source: BioPlex
TPCN2
Tchem
Family: IC
Novelty: 0.01836974
p_int: 0.969441356
p_ni: 0.026782971
p_wrong: 0.003775674
Data Source: BioPlex
Publication Statistics
PubMed Score  87.78

PubMed score by year
PubTator Score  46.41

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MGATGAAEPLQSVLWVKQQRCAVSLEPARALLRWWRSPGPGAGAPGADACSVPVSEIIAVEETDVHGKHQ
1-70
GSGKWQKMEKPYAFTVHCVKRARRHRWKWAQVTFWCPEEQLCHLWLQTLREMLEKLTSRPKHLLVFINPF
70-140
GGKGQGKRIYERKVAPLFTLASITTDIIVTEHANQAKETLYEINIDKYDGIVCVGGDGMFSEVLHGLIGR
140-210
TQRSAGVDQNHPRAVLVPSSLRIGIIPAGSTDCVCYSTVGTSDAETSALHIVVGDSLAMDVSSVHHNSTL
210-280
LRYSVSLLGYGFYGDIIKDSEKKRWLGLARYDFSGLKTFLSHHCYEGTVSFLPAQHTVGSPRDRKPCRAG
280-350
CFVCRQSKQQLEEEQKKALYGLEAAEDVEEWQVVCGKFLAINATNMSCACRRSPRGLSPAAHLGDGSSDL
350-420
ILIRKCSRFNFLRFLIRHTNQQDQFDFTFVEVYRVKKFQFTSKHMEDEDSDLKEGGKKRFGHICSSHPSC
420-490
CCTVSNSSWNCDGEVLHSPAIEVRVHCQLVRLFARGIEENPKPDSHS
490-537
MGATGAAEPLQSVLWVKQQRCAVSLEPARALLRWWRSPGPGAGAPGADACSVPVSEIIAVEETDVHGKHQGSGKWQKMEKPYAFTVHCVKRARRHRWKWAQVTFWCPEEQLCHLWLQTLREMLEKLTSRPKHLLVFINPFGGKGQGKRIYERKVAPLFTLASITTDIIVTEHANQAKETLYEINIDKYDGIVCVGGDGMFSEVLHGLIGRTQRSAGVDQNHPRAVLVPSSLRIGIIPAGSTDCVCYSTVGTSDAETSALHIVVGDSLAMDVSSVHHNSTLLRYSVSLLGYGFYGDIIKDSEKKRWLGLARYDFSGLKTFLSHHCYEGTVSFLPAQHTVGSPRDRKPCRAGCFVCRQSKQQLEEEQKKALYGLEAAEDVEEWQVVCGKFLAINATNMSCACRRSPRGLSPAAHLGDGSSDLILIRKCSRFNFLRFLIRHTNQQDQFDFTFVEVYRVKKFQFTSKHMEDEDSDLKEGGKKRFGHICSSHPSCCCTVSNSSWNCDGEVLHSPAIEVRVHCQLVRLFARGIEENPKPDSHS