You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
FAM174A
Membrane protein FAM174A

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000312637
  • ENSP00000307954
  • ENSG00000174132

Symbol
  • NS5ATP6
  • TMEM157
  • NS5ATP6
  • TMEM157
  • UNQ1912
  • HGS_RE408
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.8
transcription factor binding site profile
0.68
transcription factor
0.67
small molecule perturbation
0.61
cell type or tissue
0.55


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.84   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 45   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.84   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 45   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (1)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (76)
1 – 10 of 76
PEX19
Tbio
Novelty: 0.00469515
p_int: 0.999999949
p_ni: 5.1e-8
Score: 0.191
Data Source: BioPlex,STRINGDB
TMEM168
Tdark
Novelty: 0.52830189
p_int: 0.99999727
p_ni: 7.69e-7
p_wrong: 0.000001961
Score: 0.804
Data Source: BioPlex,STRINGDB
ATP2B2
Tbio
Family: Transporter
Novelty: 0.00724828
p_int: 0.999990458
p_ni: 0.000009542
Data Source: BioPlex
TAMM41
Tbio
Family: Enzyme
Novelty: 0.08219178
p_int: 0.999032415
p_ni: 0.000967585
Data Source: BioPlex
TTK
Tchem
Family: Kinase
Novelty: 0.00344798
p_int: 0.998839059
p_ni: 0.001160941
Data Source: BioPlex
SLC39A11
Tbio
Family: Transporter
Novelty: 0.17170679
p_int: 0.997942812
p_ni: 0.002057188
Data Source: BioPlex
COQ5
Tbio
Family: Enzyme
Novelty: 0.06729179
p_int: 0.997471497
p_ni: 0.002528503
Score: 0.173
Data Source: BioPlex,STRINGDB
NDUFB5
Tclin
Family: Enzyme
Novelty: 0.03732485
p_int: 0.99710966
p_ni: 0.001721128
p_wrong: 0.001169212
Data Source: BioPlex
TRAPPC5
Tdark
Novelty: 1.63636364
p_int: 0.99710966
p_ni: 0.001721128
p_wrong: 0.001169212
Data Source: BioPlex
FAM118B
Tdark
Novelty: 2.25
p_int: 0.995971985
p_ni: 0.004028008
p_wrong: 7e-9
Data Source: BioPlex
Publication Statistics
PubMed Score  1.84

PubMed score by year
PubTator Score  0.14

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKASQCCCCLSHLLASVLLLLLLPELSGPLAVLLQAAEAAPGLGPPDPRPRTLPPLPPGPTPAQQPGRGL
1-70
AEAAGPRGSEGGNGSNPVAGLETDDHGGKAGEGSVGGGLAVSPNPGDKPMTQRALTVLMVVSGAVLVYFV
70-140
VRTVRMRRRNRKTRRYGVLDTNIENMELTPLEQDDEDDDNTLFDANHPRR
140-190
MKASQCCCCLSHLLASVLLLLLLPELSGPLAVLLQAAEAAPGLGPPDPRPRTLPPLPPGPTPAQQPGRGLAEAAGPRGSEGGNGSNPVAGLETDDHGGKAGEGSVGGGLAVSPNPGDKPMTQRALTVLMVVSGAVLVYFVVRTVRMRRRNRKTRRYGVLDTNIENMELTPLEQDDEDDDNTLFDANHPRR