You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SETD6
N-lysine methyltransferase SETD6

Protein Summary
Description
Protein-lysine N-methyltransferase. Monomethylates 'Lys-310' of the RELA subunit of NF-kappa-B complex, leading to down-regulate NF-kappa-B transcription factor activity (PubMed:21131967). Monomethylates 'Lys-8' of H2AZ (H2AZK8me1) (PubMed:23324626). Required for the maintenance of embryonic stem cell self-renewal (By similarity). This gene encodes a methyltransferase that adds a methyl group to the histone H2AZ, which is involved in nuclear receptor-dependent transcription. The protein also interacts with several endogenous proteins which are involved in nuclear hormone receptor signaling. A related pseudogene is located on chromosome 2. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000219315
  • ENSP00000219315
  • ENSG00000103037
  • ENST00000310682
  • ENSP00000310082
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.9
virus perturbation
0.88
histone modification site profile
0.87
kinase perturbation
0.84
transcription factor binding site profile
0.71


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9.75   (req: < 5)
Gene RIFs: 10   (req: <= 3)
Antibodies: 127   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9.75   (req: >= 5)
Gene RIFs: 10   (req: > 3)
Antibodies: 127   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (4)
Chromatin modifying enzymes (R-HSA-3247509)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Chromatin modifying enzymes
Reactome
Chromatin organization
Reactome
PKMTs methylate histone lysines
Name
Explore in Pharos
Explore in Source
Chromatin modifying enzymes
Chromatin organization
PKMTs methylate histone lysines
Protein-Protein Interactions (47)
1 – 10 of 47
RPL36AL
Tbio
Novelty: 0.15524221
p_int: 0.999999955
p_ni: 3.6e-8
p_wrong: 1e-8
Score: 0.453
Data Source: BioPlex,STRINGDB
RELA
Tchem
Family: TF
Novelty: 0.00091233
Score: 0.993
Data Source: Reactome,STRINGDB
NFKB1
Tclin
Family: TF
Novelty: 0.00165205
Score: 0.908
Data Source: Reactome,STRINGDB
NFKB2
Tchem
Family: TF
Novelty: 0.00459649
Score: 0.908
Data Source: Reactome,STRINGDB
SETD4
Tdark
Family: Epigenetic
Novelty: 0.41509864
Score: 0.806
Data Source: STRINGDB
SETD7
Tchem
Family: Epigenetic
Novelty: 0.00670431
Score: 0.642
Data Source: STRINGDB
PAK4
Tchem
Family: Kinase
Novelty: 0.00577994
Score: 0.597
Data Source: STRINGDB
SETD2
Tchem
Family: Epigenetic
Novelty: 0.00129405
Score: 0.589
Data Source: STRINGDB
GAMT
Tbio
Family: Enzyme
Novelty: 0.00822106
Score: 0.562
Data Source: STRINGDB
SMYD2
Tchem
Family: Epigenetic
Novelty: 0.01010557
Score: 0.559
Data Source: STRINGDB
Publication Statistics
PubMed Score  9.75

PubMed score by year
PubTator Score  6.91

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MATQAKRPRVAGPVDGGDLDPVACFLSWCRRVGLELSPKVSERAGGRRTRGGARAALTSPPAQVAVSRQG
1-70
TVAGYGMVARESVQAGELLFVVPRAALLSQHTCSIGGLLERERVALQSQSGWVPLLLALLHELQAPASRW
70-140
RPYFALWPELGRLEHPMFWPEEERRCLLQGTGVPEAVEKDLANIRSEYQSIVLPFMEAHPDLFSLRVRSL
140-210
ELYHQLVALVMAYSFQEPLEEEEDEKEPNSPVMVPAADILNHLANHNANLEYSANCLRMVATQPIPKGHE
210-280
IFNTYGQMANWQLIHMYGFVEPYPDNTDDTADIQMVTVREAALQGTKTEAERHLVYERWDFLCKLEMVGE
280-350
EGAFVIGREEVLTEEELTTTLKVLCMPAEEFRELKDQDGGGDDKREEGSLTITNIPKLKASWRQLLQNSV
350-420
LLTLQTYATDLKTDQGLLSNKEVYAKLSWREQQALQVRYGQKMILHQLLELTS
420-473
MATQAKRPRVAGPVDGGDLDPVACFLSWCRRVGLELSPKVSERAGGRRTRGGARAALTSPPAQVAVSRQGTVAGYGMVARESVQAGELLFVVPRAALLSQHTCSIGGLLERERVALQSQSGWVPLLLALLHELQAPASRWRPYFALWPELGRLEHPMFWPEEERRCLLQGTGVPEAVEKDLANIRSEYQSIVLPFMEAHPDLFSLRVRSLELYHQLVALVMAYSFQEPLEEEEDEKEPNSPVMVPAADILNHLANHNANLEYSANCLRMVATQPIPKGHEIFNTYGQMANWQLIHMYGFVEPYPDNTDDTADIQMVTVREAALQGTKTEAERHLVYERWDFLCKLEMVGEEGAFVIGREEVLTEEELTTTLKVLCMPAEEFRELKDQDGGGDDKREEGSLTITNIPKLKASWRQLLQNSVLLTLQTYATDLKTDQGLLSNKEVYAKLSWREQQALQVRYGQKMILHQLLELTS