You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
PIGX
Phosphatidylinositol-glycan biosynthesis class X protein

Protein Summary
Description
Essential component of glycosylphosphatidylinositol-mannosyltransferase 1 which transfers the first of the 4 mannoses in the GPI-anchor precursors during GPI-anchor biosynthesis. Probably acts by stabilizing the mannosyltransferase PIGM (By similarity). This gene encodes a type I transmembrane protein in the endoplasmic reticulum (ER). The protein is an essential component of glycosylphosphatidylinositol-mannosyltransferase I, which transfers the first of the four mannoses in the GPI-anchor precursors during GPI-anchor biosynthesis. Studies in rat indicate that the protein is translated from a non-AUG translation initiation site. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000639143
  • ENSP00000492796
  • ENSG00000163964
  • ENST00000639474
  • ENSP00000491529

Symbol
  • PIG-X
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.91
disease perturbation
0.74
metabolite
0.73
virus perturbation
0.72
kinase perturbation
0.71


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.38   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 128   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.38   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 128   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Metabolism of proteins (R-HSA-392499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of proteins
Reactome
Post-translational modification: synthesis of GPI-anchored proteins
Reactome
Post-translational protein modification
Reactome
Synthesis of glycosylphosphatidylinositol (GPI)
Name
Explore in Pharos
Explore in Source
Metabolism of proteins
Post-translational modification: synthesis of GPI-anchored proteins
Post-translational protein modification
Synthesis of glycosylphosphatidylinositol (GPI)
Protein-Protein Interactions (21)
1 – 10 of 21
CHRM3
Tclin
Family: GPCR
Novelty: 0.00207684
p_int: 0.837000666
p_ni: 0.162999305
p_wrong: 2.9e-8
Score: 0.224
Data Source: BioPlex,STRINGDB
PIGM
Tbio
Family: Enzyme
Novelty: 0.02562642
Score: 0.999
Data Source: Reactome,STRINGDB
PIGV
Tbio
Family: Enzyme
Novelty: 0.07450145
Score: 0.929
Data Source: STRINGDB
PIGW
Tbio
Novelty: 0.04018898
Score: 0.902
Data Source: STRINGDB
PIGN
Tbio
Family: Enzyme
Novelty: 0.00990325
Score: 0.9
Data Source: STRINGDB
PIGB
Tbio
Family: Enzyme
Novelty: 0.04150533
Score: 0.9
Data Source: STRINGDB
DPM3
Tdark
Family: Enzyme
Novelty: 0.12547779
Score: 0.887
Data Source: STRINGDB
DPM2
Tdark
Novelty: 0.10264314
Score: 0.886
Data Source: STRINGDB
RCN2
Tbio
Novelty: 0.05431159
Score: 0.831
Data Source: STRINGDB
DPM1
Tbio
Family: Enzyme
Novelty: 0.00333047
Score: 0.824
Data Source: STRINGDB
Publication Statistics
PubMed Score  0.38

PubMed score by year
PubTator Score  2.4

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAARVAAVRAAAWLLLGAATGLTRGPAAAFTAARSDAGIRAMCSEIILRQEVLKDGFHRDLLIKVKFGES
1-70
IEDLHTCRLLIKQDIPAGLYVDPYELASLRERNITEAVMVSENFDIEAPNYLSKESEVLIYARRDSQCID
70-140
CFQAFLPVHCRYHRPHSEDGEASIVVNNPDLLMFCDQEFPILKCWAHSEVAAPCALENEDICQWNKMKYK
140-210
SVYKNVILQVPVGLTVHTSLVCSVTLLITILCSTLILVAVFKYGHFSL
210-258
MAARVAAVRAAAWLLLGAATGLTRGPAAAFTAARSDAGIRAMCSEIILRQEVLKDGFHRDLLIKVKFGESIEDLHTCRLLIKQDIPAGLYVDPYELASLRERNITEAVMVSENFDIEAPNYLSKESEVLIYARRDSQCIDCFQAFLPVHCRYHRPHSEDGEASIVVNNPDLLMFCDQEFPILKCWAHSEVAAPCALENEDICQWNKMKYKSVYKNVILQVPVGLTVHTSLVCSVTLLITILCSTLILVAVFKYGHFSL