You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SLC35B2
Adenosine 3'-phospho 5'-phosphosulfate transporter 1

Protein Summary
Description
Mediates the transport of adenosine 3'-phospho 5'-phosphosulfate (PAPS), from cytosol into Golgi. PAPS is a universal sulfuryl donor for sulfation events that take place in the Golgi. May indirectly participate in activation of the NF-kappa-B and MAPK pathways. Sulfotransferases (e.g., SULT4A1; MIM 608359) use an activated form of sulfate, 3-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS), as a common sulfate donor for sulfation of glycoproteins, proteoglycans, and glycolipids in the endoplasmic reticulum and Golgi apparatus. SLC35B2 is located in the microsomal membrane and transports PAPS from the cytosol, where it is synthesized, into the Golgi lumen (Kamiyama et al., 2003 [PubMed 12716889]).[supplied by OMIM, Mar 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000393812
  • ENSP00000377401
  • ENSG00000157593
  • ENST00000537814
  • ENSP00000440340
  • ENST00000538577
  • ENSP00000443845
  • ENST00000615337
  • ENSP00000480681
  • ENST00000619636
  • ENSP00000483181

Symbol
  • PAPST1
  • SLL
  • PAPST1
  • UGTrel4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
pathway
0.99
biological process
0.84
ligand (protein) perturbation
0.83
transcription factor binding site profile
0.8
molecular function
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 212.73   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 91   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 212.73   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 91   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (11)
Biological oxidations (R-HSA-211859)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 11
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Biological oxidations
Reactome
Cytosolic sulfonation of small molecules
Reactome
Glycosaminoglycan metabolism
Reactome
Metabolism
Reactome
Metabolism of carbohydrates
Name
Explore in Pharos
Explore in Source
Biological oxidations
Cytosolic sulfonation of small molecules
Glycosaminoglycan metabolism
Metabolism
Metabolism of carbohydrates
Protein-Protein Interactions (100)
1 – 10 of 100
SLC22A9
Tbio
Family: Transporter
Novelty: 0.02803169
p_int: 0.998857279
p_ni: 0.00114272
Data Source: BioPlex
TYROBP
Tbio
Family: Enzyme
Novelty: 0.00522854
p_int: 0.998738888
p_ni: 0.001261062
p_wrong: 5e-8
Data Source: BioPlex
LRRC55
Tbio
Family: IC
Novelty: 0.37735849
p_int: 0.998700078
p_ni: 0.001294438
p_wrong: 0.000005484
Data Source: BioPlex
SLC39A12
Tbio
Family: Transporter
Novelty: 0.11255353
p_int: 0.995193402
p_ni: 0.004806595
p_wrong: 2e-9
Data Source: BioPlex
CMKLR1
Tchem
Family: GPCR
Novelty: 0.00748603
p_int: 0.993480112
p_ni: 0.006519824
p_wrong: 6.4e-8
Data Source: BioPlex
SLC7A14
Tbio
Family: Transporter
Novelty: 0.17811121
p_int: 0.992373302
p_ni: 0.007616726
p_wrong: 0.000009972
Data Source: BioPlex
SYP
Tbio
Novelty: 0.00030664
p_int: 0.991311263
p_ni: 0.008678446
p_wrong: 0.000010291
Score: 0.167
Data Source: BioPlex,STRINGDB
SLC7A1
Tbio
Family: Transporter
Novelty: 0.00093544
p_int: 0.987436649
p_ni: 0.012563346
p_wrong: 5e-9
Score: 0.169
Data Source: BioPlex,STRINGDB
SLC15A1
Tchem
Family: Transporter
Novelty: 0.00170028
p_int: 0.985559191
p_ni: 0.014440802
p_wrong: 7e-9
Score: 0.17
Data Source: BioPlex,STRINGDB
SCN3B
Tbio
Family: IC
Novelty: 0.08995222
p_int: 0.974852134
p_ni: 0.023622081
p_wrong: 0.001525786
Data Source: BioPlex
Publication Statistics
PubMed Score  212.73

PubMed score by year
PubTator Score  106.54

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDARWWAVVVLAAFPSLGAGGETPEAPPESWTQLWFFRFVVNAAGYASFMVPGYLLVQYFRRKNYLETGR
1-70
GLCFPLVKACVFGNEPKASDEVPLAPRTEAAETTPMWQALKLLFCATGLQVSYLTWGVLQERVMTRSYGA
70-140
TATSPGERFTDSQFLVLMNRVLALIVAGLSCVLCKQPRHGAPMYRYSFASLSNVLSSWCQYEALKFVSFP
140-210
TQVLAKASKVIPVMLMGKLVSRRSYEHWEYLTATLISIGVSMFLLSSGPEPRSSPATTLSGLILLAGYIA
210-280
FDSFTSNWQDALFAYKMSSVQMMFGVNFFSCLFTVGSLLEQGALLEGTRFMGRHSEFAAHALLLSICSAC
280-350
GQLFIFYTIGQFGAAVFTIIMTLRQAFAILLSCLLYGHTVTVVGGLGVAVVFAALLLRVYARGRLKQRGK
350-420
KAVPVESPVQKV
420-432
MDARWWAVVVLAAFPSLGAGGETPEAPPESWTQLWFFRFVVNAAGYASFMVPGYLLVQYFRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETTPMWQALKLLFCATGLQVSYLTWGVLQERVMTRSYGATATSPGERFTDSQFLVLMNRVLALIVAGLSCVLCKQPRHGAPMYRYSFASLSNVLSSWCQYEALKFVSFPTQVLAKASKVIPVMLMGKLVSRRSYEHWEYLTATLISIGVSMFLLSSGPEPRSSPATTLSGLILLAGYIAFDSFTSNWQDALFAYKMSSVQMMFGVNFFSCLFTVGSLLEQGALLEGTRFMGRHSEFAAHALLLSICSACGQLFIFYTIGQFGAAVFTIIMTLRQAFAILLSCLLYGHTVTVVGGLGVAVVFAALLLRVYARGRLKQRGKKAVPVESPVQKV