You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
COQ8A
Atypical kinase COQ8A, mitochondrial

Protein Summary
Description
Atypical kinase involved in the biosynthesis of coenzyme Q, also named ubiquinone, an essential lipid-soluble electron transporter for aerobic cellular respiration (PubMed:25498144, PubMed:21296186, PubMed:25540914, PubMed:27499294). Its substrate specificity is unclear: does not show any protein kinase activity (PubMed:25498144, PubMed:27499294). Probably acts as a small molecule kinase, possibly a lipid kinase that phosphorylates a prenyl lipid in the ubiquinone biosynthesis pathway, as suggested by its ability to bind coenzyme Q lipid intermediates (PubMed:25498144, PubMed:27499294). Shows an unusual selectivity for binding ADP over ATP (PubMed:25498144). This gene encodes a mitochondrial protein similar to yeast ABC1, which functions in an electron-transferring membrane protein complex in the respiratory chain. It is not related to the family of ABC transporter proteins. Expression of this gene is induced by the tumor suppressor p53 and in response to DNA damage, and inhibiting its ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000366777
  • ENSP00000355739
  • ENSG00000163050
  • ENST00000366778
  • ENSP00000355740
  • ENST00000366779
  • ENSP00000355741

Symbol
  • ADCK3
  • CABC1
  • COQ8
  • ADCK3
  • ARCA2
  • CABC1
  • SCAR9
  • COQ10D4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 38.83   (req: < 5)
Gene RIFs: 10   (req: <= 3)
Antibodies: 294   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 38.83   (req: >= 5)
Gene RIFs: 10   (req: > 3)
Antibodies: 294   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (1)
Items per page:
1 – 1 of 1
Data Source
Name
Explore in Pharos
Explore in Source
UniProt
Cofactor biosynthesis; ubiquinone biosynthesis.
Name
Explore in Pharos
Explore in Source
Cofactor biosynthesis; ubiquinone biosynthesis.
Gene Ontology Terms (9)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (70)
1 – 10 of 70
DOK2
Tbio
Novelty: 0.03008362
p_int: 0.959037018
p_ni: 0.040962982
Score: 0.297
Data Source: BioPlex,STRINGDB
GAPDHS
Tbio
Family: Enzyme
Novelty: 0.01313187
p_int: 0.944761949
p_ni: 0.055237956
p_wrong: 9.5e-8
Score: 0.22
Data Source: BioPlex,STRINGDB
COQ9
Tbio
Novelty: 0.005822
Score: 0.969
Data Source: STRINGDB
COQ3
Tbio
Family: Enzyme
Novelty: 0.04494536
Score: 0.959
Data Source: STRINGDB
COQ5
Tbio
Family: Enzyme
Novelty: 0.06729179
Score: 0.953
Data Source: STRINGDB
COQ4
Tbio
Novelty: 0.04287391
Score: 0.939
Data Source: STRINGDB
COQ7
Tbio
Family: Enzyme
Novelty: 0.00611116
Score: 0.934
Data Source: STRINGDB
PDSS1
Tbio
Family: Enzyme
Novelty: 0.01260939
Score: 0.93
Data Source: STRINGDB
COQ6
Tbio
Family: Enzyme
Novelty: 0.03821723
Score: 0.926
Data Source: STRINGDB
COQ2
Tbio
Family: Enzyme
Novelty: 0.00796005
Score: 0.925
Data Source: STRINGDB
Publication Statistics
PubMed Score  38.83

PubMed score by year
PubTator Score  25.25

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQGQDKHEEYFAE
1-70
NFGGPEGEFHFSVPHAAGASTDFSSASAPDQSAPPSLGHAHSEGPAPAYVASGPFREAGFPGQASSPLGR
70-140
ANGRLFANPRDSFSAMGFQRRFFHQDQSPVGGLTAEDIEKARQAKARPENKQHKQTLSEHARERKVPVTR
140-210
IGRLANFGGLAVGLGFGALAEVAKKSLRSEDPSGKKAVLGSSPFLSEANAERIVRTLCKVRGAALKLGQM
210-280
LSIQDDAFINPHLAKIFERVRQSADFMPLKQMMKTLNNDLGPNWRDKLEYFEERPFAAASIGQVHLARMK
280-350
GGREVAMKIQYPGVAQSINSDVNNLMAVLNMSNMLPEGLFPEHLIDVLRRELALECDYQREAACARKFRD
350-420
LLKGHPFFYVPEIVDELCSPHVLTTELVSGFPLDQAEGLSQEIRNEICYNILVLCLRELFEFHFMQTDPN
420-490
WSNFFYDPQQHKVALLDFGATREYDRSFTDLYIQIIRAAADRDRETVRAKSIEMKFLTGYEVKVMEDAHL
490-560
DAILILGEAFASDEPFDFGTQSTTEKIHNLIPVMLRHRLVPPPEETYSLHRKMGGSFLICSKLKARFPCK
560-630
AMFEEAYSNYCKRQAQQ
630-647
MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQGQDKHEEYFAENFGGPEGEFHFSVPHAAGASTDFSSASAPDQSAPPSLGHAHSEGPAPAYVASGPFREAGFPGQASSPLGRANGRLFANPRDSFSAMGFQRRFFHQDQSPVGGLTAEDIEKARQAKARPENKQHKQTLSEHARERKVPVTRIGRLANFGGLAVGLGFGALAEVAKKSLRSEDPSGKKAVLGSSPFLSEANAERIVRTLCKVRGAALKLGQMLSIQDDAFINPHLAKIFERVRQSADFMPLKQMMKTLNNDLGPNWRDKLEYFEERPFAAASIGQVHLARMKGGREVAMKIQYPGVAQSINSDVNNLMAVLNMSNMLPEGLFPEHLIDVLRRELALECDYQREAACARKFRDLLKGHPFFYVPEIVDELCSPHVLTTELVSGFPLDQAEGLSQEIRNEICYNILVLCLRELFEFHFMQTDPNWSNFFYDPQQHKVALLDFGATREYDRSFTDLYIQIIRAAADRDRETVRAKSIEMKFLTGYEVKVMEDAHLDAILILGEAFASDEPFDFGTQSTTEKIHNLIPVMLRHRLVPPPEETYSLHRKMGGSFLICSKLKARFPCKAMFEEAYSNYCKRQAQQ