You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CDC26
Anaphase-promoting complex subunit CDC26

Protein Summary
Description
Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. May recruit the E2 ubiquitin-conjugating enzymes to the complex. The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Cdc26, a component of cell cycle anaphase-promoting complex (APC). APC is composed of a group of highly conserved proteins and functions as a cell cycle-regulated ubiquitin-protein ligase. APC thus is responsible for the cell cycle regulated proteolysis of various proteins. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000374206
  • ENSP00000363322
  • ENSG00000176386

Symbol
  • ANAPC12
  • C9orf17
  • APC12
  • ANAPC12
  • C9orf17
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.97
biological process
0.94
histone modification site profile
0.89
transcription factor binding site profile
0.76
tissue sample
0.71


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.56   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 75   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.56   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 75   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (10)
1 – 5 of 10
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (43)
APC-Cdc20 mediated degradation of Nek2A (R-HSA-179409)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 37
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
APC-Cdc20 mediated degradation of Nek2A
Reactome
APC/C-mediated degradation of cell cycle proteins
Reactome
APC/C:Cdc20 mediated degradation of Cyclin B
Reactome
APC/C:Cdc20 mediated degradation of Securin
Reactome
APC/C:Cdc20 mediated degradation of mitotic proteins
Name
Explore in Pharos
Explore in Source
APC-Cdc20 mediated degradation of Nek2A
APC/C-mediated degradation of cell cycle proteins
APC/C:Cdc20 mediated degradation of Cyclin B
APC/C:Cdc20 mediated degradation of Securin
APC/C:Cdc20 mediated degradation of mitotic proteins
Gene Ontology Terms (9)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
HPA
Traceable Author Statement (TAS)
Reactome
Protein-Protein Interactions (384)
1 – 10 of 384
ANAPC2
Tbio
Family: Enzyme
Novelty: 0.25398893
p_int: 0.999999941
p_ni: 5.9e-8
Score: 0.999
Data Source: BioPlex,STRINGDB
ANAPC4
Tbio
Family: Enzyme
Novelty: 1.93548387
p_int: 0.99999979
p_ni: 2.1e-7
Score: 0.999
Data Source: BioPlex,STRINGDB
ANAPC13
Tbio
Family: Enzyme
Novelty: 0.0994907
p_int: 0.999999684
p_ni: 3.16e-7
Score: 0.999
Data Source: BioPlex,STRINGDB
CDC16
Tbio
Novelty: 0.01336597
p_int: 0.999999157
p_ni: 8.43e-7
Score: 0.999
Data Source: BioPlex,STRINGDB
FBXO5
Tbio
Novelty: 0.01799521
p_int: 0.999998323
p_ni: 0.000001677
Score: 0.991
Data Source: BioPlex,STRINGDB
CDC27
Tbio
Novelty: 0.00956925
p_int: 0.999998104
p_ni: 0.000001896
Score: 0.999
Data Source: BioPlex,STRINGDB
CDC23
Tbio
Novelty: 0.02675154
p_int: 0.999997546
p_ni: 0.000002454
Score: 0.999
Data Source: BioPlex,STRINGDB
ANAPC5
Tbio
Family: Enzyme
Novelty: 0.0345899
p_int: 0.999995545
p_ni: 0.000004171
p_wrong: 2.84e-7
Score: 0.999
Data Source: BioPlex,STRINGDB
ANAPC16
Tdark
Family: Enzyme
Novelty: 0.09302326
p_int: 0.999978285
p_ni: 0.000021584
p_wrong: 1.33e-7
Score: 0.999
Data Source: BioPlex,STRINGDB
ANAPC1
Tbio
Family: Enzyme
Novelty: 0.02248926
p_int: 0.999954882
p_ni: 0.000045118
Score: 0.999
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  6.56

PubMed score by year
PubTator Score  5.56

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQ
1-70
PKPNNRSSQFGSLEF
70-85
MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF