You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
TPCN2
Two pore calcium channel protein 2

Protein Summary
Description
Nicotinic acid adenine dinucleotide phosphate (NAADP) receptor that may function as one of the major voltage-gated Ca(2+) channels (VDCC) across the lysosomal membrane. May be involved in smooth muscle contraction. This gene encodes a putative cation-selective ion channel with two repeats of a six-transmembrane-domain. The protein localizes to lysosomal membranes and enables nicotinic acid adenine dinucleotide phosphate (NAADP) -induced calcium ion release from lysosome-related stores. This ubiquitously expressed gene has elevated expression in liver and kidney. Two common nonsynonymous SNPs in this gene strongly associate with blond versus brown hair pigmentation.[provided by RefSeq, Dec 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000294309
  • ENSP00000294309
  • ENSG00000162341

Symbol
  • TPC2
  • TPC2
  • SHEP10
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.96
cell line
0.59
cellular component
0.56
histone modification site profile
0.56
biological process
0.55


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 54.54   (req: < 5)
Gene RIFs: 24   (req: <= 3)
Antibodies: 71   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 54.54   (req: >= 5)
Gene RIFs: 24   (req: > 3)
Antibodies: 71   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
verapamil
chemical structure image
Pathways (8)
Ion channel transport (R-HSA-983712)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Ion channel transport
Reactome
Stimuli-sensing channels
Reactome
Transport of small molecules
Name
Explore in Pharos
Explore in Source
Ion channel transport
Stimuli-sensing channels
Transport of small molecules
Protein-Protein Interactions (102)
1 – 10 of 102
TMEM154
Tdark
Novelty: 0.08876933
p_int: 0.999999544
p_ni: 4.56e-7
Data Source: BioPlex
ANKRD27
Tbio
Novelty: 0.07805256
p_int: 0.999997386
p_ni: 0.000002611
p_wrong: 2e-9
Score: 0.179
Data Source: BioPlex,STRINGDB
AGBL5
Tbio
Family: Enzyme
Novelty: 0.09110629
p_int: 0.999997229
p_ni: 0.000002771
Data Source: BioPlex
USP32
Tbio
Family: Enzyme
Novelty: 0.06653479
p_int: 0.99992695
p_ni: 0.00007305
Score: 0.301
Data Source: BioPlex,STRINGDB
DENND6A
Tbio
Novelty: 8
p_int: 0.999695866
p_ni: 0.000304134
Data Source: BioPlex
TRAPPC8
Tdark
Novelty: 0.08933319
p_int: 0.999244102
p_ni: 0.000755898
Score: 0.174
Data Source: BioPlex,STRINGDB
WDR44
Tdark
Novelty: 0.06367254
p_int: 0.998743296
p_ni: 0.001256704
Data Source: BioPlex
PTPRA
Tchem
Family: Enzyme
Novelty: 0.01725567
p_int: 0.998536699
p_ni: 0.000027812
p_wrong: 0.001435488
Score: 0.158
Data Source: BioPlex,STRINGDB
CLCN3
Tchem
Family: IC
Novelty: 0.00483776
p_int: 0.997947216
p_ni: 0.002045274
p_wrong: 0.00000751
Score: 0.172
Data Source: BioPlex,STRINGDB
FBXO10
Tbio
Novelty: 0.28307956
p_int: 0.99694949
p_ni: 0.002653057
p_wrong: 0.000397453
Data Source: BioPlex
Publication Statistics
PubMed Score  54.54

PubMed score by year
PubTator Score  43.02

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MAEPQAESEPLLGGARGGGGDWPAGLTTYRSIQVGPGAAARWDLCIDQAVVFIEDAIQYRSINHRVDASS
1-70
MWLYRRYYSNVCQRTLSFTIFLILFLAFIETPSSLTSTADVRYRAAPWEPPCGLTESVEVLCLLVFAADL
70-140
SVKGYLFGWAHFQKNLWLLGYLVVLVVSLVDWTVSLSLVCHEPLRIRRLLRPFFLLQNSSMMKKTLKCIR
140-210
WSLPEMASVGLLLAIHLCLFTMFGMLLFAGGKQDDGQDRERLTYFQNLPESLTSLLVLLTTANNPDVMIP
210-280
AYSKNRAYAIFFIVFTVIGSLFLMNLLTAIIYSQFRGYLMKSLQTSLFRRRLGTRAAFEVLSSMVGEGGA
280-350
FPQAVGVKPQNLLQVLQKVQLDSSHKQAMMEKVRSYGSVLLSAEEFQKLFNELDRSVVKEHPPRPEYQSP
350-420
FLQSAQFLFGHYYFDYLGNLIALANLVSICVFLVLDADVLPAERDDFILGILNCVFIVYYLLEMLLKVFA
420-490
LGLRGYLSYPSNVFDGLLTVVLLVLEISTLAVYRLPHPGWRPEMVGLLSLWDMTRMLNMLIVFRFLRIIP
490-560
SMKLMAVVASTVLGLVQNMRAFGGILVVVYYVFAIIGINLFRGVIVALPGNSSLAPANGSAPCGSFEQLE
560-630
YWANNFDDFAAALVTLWNLMVVNNWQVFLDAYRRYSGPWSKIYFVLWWLVSSVIWVNLFLALILENFLHK
630-700
WDPRSHLQPLAGTPEATYQMTVELLFRDILEEPGEDELTERLSQHPHLWLCR
700-752
MAEPQAESEPLLGGARGGGGDWPAGLTTYRSIQVGPGAAARWDLCIDQAVVFIEDAIQYRSINHRVDASSMWLYRRYYSNVCQRTLSFTIFLILFLAFIETPSSLTSTADVRYRAAPWEPPCGLTESVEVLCLLVFAADLSVKGYLFGWAHFQKNLWLLGYLVVLVVSLVDWTVSLSLVCHEPLRIRRLLRPFFLLQNSSMMKKTLKCIRWSLPEMASVGLLLAIHLCLFTMFGMLLFAGGKQDDGQDRERLTYFQNLPESLTSLLVLLTTANNPDVMIPAYSKNRAYAIFFIVFTVIGSLFLMNLLTAIIYSQFRGYLMKSLQTSLFRRRLGTRAAFEVLSSMVGEGGAFPQAVGVKPQNLLQVLQKVQLDSSHKQAMMEKVRSYGSVLLSAEEFQKLFNELDRSVVKEHPPRPEYQSPFLQSAQFLFGHYYFDYLGNLIALANLVSICVFLVLDADVLPAERDDFILGILNCVFIVYYLLEMLLKVFALGLRGYLSYPSNVFDGLLTVVLLVLEISTLAVYRLPHPGWRPEMVGLLSLWDMTRMLNMLIVFRFLRIIPSMKLMAVVASTVLGLVQNMRAFGGILVVVYYVFAIIGINLFRGVIVALPGNSSLAPANGSAPCGSFEQLEYWANNFDDFAAALVTLWNLMVVNNWQVFLDAYRRYSGPWSKIYFVLWWLVSSVIWVNLFLALILENFLHKWDPRSHLQPLAGTPEATYQMTVELLFRDILEEPGEDELTERLSQHPHLWLCR