You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
TERB2
Telomere repeats-binding bouquet formation protein 2

Protein Summary
Description
Meiosis-specific telomere-associated protein involved in meiotic telomere attachment to the nucleus inner membrane, a crucial step for homologous pairing and synapsis. Component of the MAJIN-TERB1-TERB2 complex, which promotes telomere cap exchange by mediating attachment of telomeric DNA to the inner nuclear membrane and replacement of the protective cap of telomeric chromosomes: in early meiosis, the MAJIN-TERB1-TERB2 complex associates with telomeric DNA and the shelterin/telosome complex. During prophase, the complex matures and promotes release of the shelterin/telosome complex from telomeric DNA.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000340827
  • ENSP00000340644
  • ENSG00000167014

Symbol
  • C15orf43
  • C15orf43
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.01   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 6   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.01   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 6   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (5)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Protein-Protein Interactions (20)
1 – 10 of 20
RIBC1
Tdark
Novelty: 0.55837563
Score: 0.802
Data Source: STRINGDB
MAJIN
Tdark
Novelty: 0.45454545
Score: 0.774
Data Source: STRINGDB
C1orf43
Tdark
Novelty: 0.23734247
Score: 0.724
Data Source: STRINGDB
CABP2
Tbio
Novelty: 0.11583012
Score: 0.695
Data Source: STRINGDB
TERB1
Tdark
Family: TF
Novelty: 0.30456853
Score: 0.676
Data Source: STRINGDB
OR2T5
Tdark
Family: oGPCR
Novelty: 9
Score: 0.675
Data Source: STRINGDB
QSER1
Tdark
Novelty: 2.55483871
Score: 0.56
Data Source: STRINGDB
KRTAP21-1
Tdark
Novelty: 1
Score: 0.554
Data Source: STRINGDB
PCDHA13
Tdark
Novelty: 3.23809524
Score: 0.552
Data Source: STRINGDB
PRIMA1
Tbio
Novelty: 0.00142786
Score: 0.548
Data Source: STRINGDB
Publication Statistics
PubMed Score  1.01

PubMed score by year
PubTator Score  0.13

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MFQGQRGWFCGSVSQDLRQFWVAEGGTISDPRAADFLFSCDASHPDTLRIYQSLDYIEDNATVFHAYYLS
1-70
AVANAKIKNSVALGHFILPPACLQKEIRRKIGSFIWEQDQHFLIEKHDEVTPNEIKTLRENSELATEHKK
70-140
ELSKSPEKHFIRTPVVEKQMYFPLQNYPVNNMVTGYISIDAMKKFLGELHDFIPGTSGYLAYHVQNEINM
140-210
SAIKNKLKRK
210-220
MFQGQRGWFCGSVSQDLRQFWVAEGGTISDPRAADFLFSCDASHPDTLRIYQSLDYIEDNATVFHAYYLSAVANAKIKNSVALGHFILPPACLQKEIRRKIGSFIWEQDQHFLIEKHDEVTPNEIKTLRENSELATEHKKELSKSPEKHFIRTPVVEKQMYFPLQNYPVNNMVTGYISIDAMKKFLGELHDFIPGTSGYLAYHVQNEINMSAIKNKLKRK