You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MOSPD2
Motile sperm domain-containing protein 2

Protein Summary
Description
Promotes migration of primary monocytes and neutrophils, in response to various chemokines.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000380492
  • ENSP00000369860
  • ENSG00000130150
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.93
interacting protein
0.85
histone modification site profile
0.84
virus perturbation
0.83
disease perturbation
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.27   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 78   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.27   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 78   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (3)
Immune System (R-HSA-168256)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Immune System
Reactome
Innate Immune System
Reactome
Neutrophil degranulation
Name
Explore in Pharos
Explore in Source
Immune System
Innate Immune System
Neutrophil degranulation
Protein-Protein Interactions (153)
1 – 10 of 153
LSMEM2
Tdark
p_int: 0.999999986
p_ni: 1.4e-8
Data Source: BioPlex
PEX19
Tbio
Novelty: 0.00469515
p_int: 0.999998319
p_ni: 0.000001681
Data Source: BioPlex
GNG2
Tbio
Novelty: 0.08273543
p_int: 0.999993042
p_ni: 0.000006958
p_wrong: 1e-9
Data Source: BioPlex
FAM187B
Tdark
Novelty: 0.90909091
p_int: 0.99998349
p_ni: 0.00001651
Score: 0.175
Data Source: BioPlex,STRINGDB
STX12
Tbio
Novelty: 0.07003045
p_int: 0.999237249
p_ni: 0.000762744
p_wrong: 6e-9
Data Source: BioPlex
VAPA
Tbio
Novelty: 0.0022428
p_int: 0.998909712
p_ni: 0.001090287
p_wrong: 1e-9
Score: 0.278
Data Source: BioPlex,STRINGDB
TGFA
Tbio
Novelty: 0.00259473
p_int: 0.998629952
p_ni: 0.001370048
Data Source: BioPlex
OR13J1
Tdark
Family: oGPCR
p_int: 0.998144036
p_ni: 0.001855964
Data Source: BioPlex
PALM2
Tbio
Novelty: 0.07313425
p_int: 0.998126851
p_ni: 0.001870102
p_wrong: 0.000003046
Score: 0.169
Data Source: BioPlex,STRINGDB
GNG4
Tdark
Novelty: 0.2302777
p_int: 0.997302626
p_ni: 0.002697222
p_wrong: 1.52e-7
Score: 0.179
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  4.27

PubMed score by year
PubTator Score  2.13

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAENHAQNKAKLISETRRRFEAEYVTDKSDKYDARDVERLQQDDNWVESYLSWRHNIVDETLKMLDESFQ
1-70
WRKEISVNDLNESSIPRWLLEIGVIYLHGYDKEGNKLFWIRVKYHVKDQKTILDKKKLIAFWLERYAKRE
70-140
NGKPVTVMFDLSETGINSIDMDFVRFIINCFKVYYPKYLSKIVIFDMPWLMNAAFKIVKTWLGPEAVSLL
140-210
KFTSKNEVQDYVSVEYLPPHMGGTDPFKYSYPPLVDDDFQTPLCENGPITSEDETSSKEDIESDGKETLE
210-280
TISNEEQTPLLKKINPTESTSKAEENEKVDSKVKAFKKPLSVFKGPLLHISPAEELYFGSTESGEKKTLI
280-350
VLTNVTKNIVAFKVRTTAPEKYRVKPSNSSCDPGASVDIVVSPHGGLTVSAQDRFLIMAAEMEQSSGTGP
350-420
AELTQFWKEVPRNKVMEHRLRCHTVESSKPNTLTLKDNAFNMSDKTSEDICLQLSRLLESNRKLEDQVQR
420-490
CIWFQQLLLSLTMLLLAFVTSFFYLLYS
490-518
MAENHAQNKAKLISETRRRFEAEYVTDKSDKYDARDVERLQQDDNWVESYLSWRHNIVDETLKMLDESFQWRKEISVNDLNESSIPRWLLEIGVIYLHGYDKEGNKLFWIRVKYHVKDQKTILDKKKLIAFWLERYAKRENGKPVTVMFDLSETGINSIDMDFVRFIINCFKVYYPKYLSKIVIFDMPWLMNAAFKIVKTWLGPEAVSLLKFTSKNEVQDYVSVEYLPPHMGGTDPFKYSYPPLVDDDFQTPLCENGPITSEDETSSKEDIESDGKETLETISNEEQTPLLKKINPTESTSKAEENEKVDSKVKAFKKPLSVFKGPLLHISPAEELYFGSTESGEKKTLIVLTNVTKNIVAFKVRTTAPEKYRVKPSNSSCDPGASVDIVVSPHGGLTVSAQDRFLIMAAEMEQSSGTGPAELTQFWKEVPRNKVMEHRLRCHTVESSKPNTLTLKDNAFNMSDKTSEDICLQLSRLLESNRKLEDQVQRCIWFQQLLLSLTMLLLAFVTSFFYLLYS