You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LILRB1
Leukocyte immunoglobulin-like receptor subfamily B member 1

Protein Classes
Protein Summary
Description
Receptor for class I MHC antigens. Recognizes a broad spectrum of HLA-A, HLA-B, HLA-C and HLA-G alleles. Receptor for H301/UL18, a human cytomegalovirus class I MHC homolog. Ligand binding results in inhibitory signals and down-regulation of the immune response. Engagement of LILRB1 present on natural killer cells or T-cells by class I MHC molecules protects the target cells from lysis. Interaction with HLA-B or HLA-E leads to inhibition of FCER1A signaling and serotonin release. Inhibits FCGR1A-mediated phosphorylation of cellular proteins and mobilization of intracellular calcium ions (PubMed:11907092, PubMed:9285411, PubMed:9842885). Recognizes HLA-G in complex with B2M/beta-2 microglobulin and a nonamer self-peptide (PubMed:16455647). Upon interaction with peptide-bound HLA-G-B2M complex, triggers secretion of growth-promoting factors by decidual NK cells (PubMed:29262349, PubMed:19304799). Reprograms B cells toward an immune suppressive phenotype (PubMed:24453251). This gene is a ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000448689
  • ENSP00000409968
  • ENSG00000104972
  • ENST00000612636
  • ENSP00000479887
  • ENSG00000277807
  • ENST00000616408
  • ENSP00000481700
  • ENSG00000274669
  • ENST00000617686
  • ENSP00000478282
  • ENST00000618055
  • ENSP00000480365
  • ENST00000618681
  • ENSP00000479753

Symbol
  • ILT2
  • LIR1
  • MIR7
  • ILT2
  • LIR1
  • MIR7
  • PIRB
  • CD85J
  • ILT-2
  • LIR-1
  • MIR-7
  • PIR-B
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
molecular function
0.81
biological term
0.77
tissue sample
0.68
cell line
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 185.09   (req: < 5)
Gene RIFs: 84   (req: <= 3)
Antibodies: 0   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 185.09   (req: >= 5)
Gene RIFs: 84   (req: > 3)
Antibodies: 0   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 48
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (9)
1 – 5 of 9
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (5)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Immune System
Reactome
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Immune System
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Gene Ontology Terms (53)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Protein-Protein Interactions (155)
1 – 10 of 155
LILRA3
Tdark
p_int: 0.999999994
p_wrong: 6e-9
Data Source: BioPlex
HLA-A
Tbio
Novelty: 0.00378961
Score: 0.996
Data Source: STRINGDB
HLA-A
Tbio
Novelty: 0.00378961
Score: 0.996
Data Source: STRINGDB
HLA-A
Tbio
Novelty: 0.00378961
Score: 0.996
Data Source: STRINGDB
HLA-A
Tbio
Novelty: 0.00378961
Score: 0.996
Data Source: STRINGDB
HLA-A
Tbio
Novelty: 0.00378961
Score: 0.996
Data Source: STRINGDB
HLA-A
Tbio
Novelty: 0.00378961
Score: 0.996
Data Source: STRINGDB
HLA-A
Tbio
Novelty: 0.00378961
Score: 0.996
Data Source: STRINGDB
HLA-A
Tbio
Novelty: 0.00378961
Score: 0.996
Data Source: STRINGDB
HLA-A
Tbio
Novelty: 0.00378961
Score: 0.996
Data Source: STRINGDB
Publication Statistics
PubMed Score  185.09

PubMed score by year
PubTator Score  237.09

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWI
1-70
TRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGN
70-140
VILQCDSQVAFDGFSLCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSL
140-210
PSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQA
210-280
NFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQG
280-350
WMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVS
350-420
GPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHLGVVIGILVAVILLLLLLLLLFLILRHRRQGK
420-490
HWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKHTQPEDGVEMDTRSPHDEDPQAV
490-560
TYAEVKHSRPRREMASPPSPLSGEFLDTKDRQAEEDRQMDTEAAASEAPQDVTYAQLHSLTLRREATEPP
560-630
PSQEGPSPAVPSIYATLAIH
630-650
MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVILQCDSQVAFDGFSLCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHLGVVIGILVAVILLLLLLLLLFLILRHRRQGKHWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKHTQPEDGVEMDTRSPHDEDPQAVTYAEVKHSRPRREMASPPSPLSGEFLDTKDRQAEEDRQMDTEAAASEAPQDVTYAQLHSLTLRREATEPPPSQEGPSPAVPSIYATLAIH