You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
TTLL11
Tubulin polyglutamylase TTLL11

Protein Summary
Description
Polyglutamase which preferentially modifies alpha-tubulin. Involved in the side-chain elongation step of the polyglutamylation reaction rather than in the initiation step (By similarity). Required for CCSAP localization to both spindle and cilia microtubules (PubMed:22493317). Generates long side-chains (By similarity).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000321582
  • ENSP00000321346
  • ENSG00000175764
  • ENST00000373776
  • ENSP00000362881

Symbol
  • C9orf20
  • C9orf20
  • bA244O19.1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor binding site profile
0.72
tissue sample
0.67
histone modification site profile
0.64
transcription factor
0.62
transcription factor perturbation
0.54


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.36   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 16   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.36   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 16   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (3)
Carboxyterminal post-translational modifications of tubulin (R-HSA-8955332)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Carboxyterminal post-translational modifications of tubulin
Reactome
Metabolism of proteins
Reactome
Post-translational protein modification
Name
Explore in Pharos
Explore in Source
Carboxyterminal post-translational modifications of tubulin
Metabolism of proteins
Post-translational protein modification
Gene Ontology Terms (7)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (30)
1 – 10 of 30
TTLL12
Tbio
Family: Enzyme
Novelty: 0.19565217
Score: 0.679
Data Source: STRINGDB
GLT6D1
Tbio
Family: Enzyme
Novelty: 0.21848739
Score: 0.665
Data Source: STRINGDB
CRTC3
Tbio
Novelty: 0.05648333
Score: 0.637
Data Source: STRINGDB
AGBL4
Tbio
Family: Enzyme
Novelty: 0.12261879
Score: 0.604
Data Source: STRINGDB
ZSCAN20
Tdark
Family: TF
Novelty: 0.75
Score: 0.594
Data Source: STRINGDB
AGTPBP1
Tbio
Family: Enzyme
Novelty: 0.02200957
Score: 0.588
Data Source: STRINGDB
FAM83E
Tdark
Novelty: 2.72727273
Score: 0.581
Data Source: STRINGDB
TMEM214
Tdark
Novelty: 1.5
Score: 0.575
Data Source: STRINGDB
FUT1
Tbio
Family: Enzyme
Novelty: 0.00748704
Score: 0.549
Data Source: STRINGDB
AGBL5
Tbio
Family: Enzyme
Novelty: 0.09110629
Score: 0.548
Data Source: STRINGDB
Publication Statistics
PubMed Score  0.36

PubMed score by year
PubTator Score  0.53

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAAASVTGRVTWAASPMRSLGLGRRLSLPGPRLDAVTAAVNPSLSDHGNGLGRGTRGSGCSGGSLVADW
1-70
GGGAAAAAAVALALAPALSTMRRGSSESELAARWEAEAVAAAKAAAKAEAEATAETVAEQVRVDAGAAGE
70-140
PECKAGEEQPKVLAPAPAQPSAAEEGNTQVLQRPPPTLPPSKPKPVQGLCPHGKPRDKGRSCKRSSGHGS
140-210
GENGSQRPVTVDSSKARTSLDALKISIRQLKWKEFPFGRRLPCDIYWHGVSFHDNDIFSGQVNKFPGMTE
210-280
MVRKITLSRAVRTMQNLFPEEYNFYPRSWILPDEFQLFVAQVQMVKDDDPSWKPTFIVKPDGGCQGDGIY
280-350
LIKDPSDIRLAGTLQSRPAVVQEYICKPLLIDKLKFDIRLYVLLKSLDPLEIYIAKDGLSRFCTEPYQEP
350-420
TPKNLHRIFMHLTNYSLNIHSGNFIHSDSASTGSKRTFSSILCRLSSKGVDIKKVWSDIISVVIKTVIAL
420-490
TPELKVFYQSDIPTGRPGPTCFQILGFDILLMKNLKPILLEVNANPSMRIEHEHELSPGVFENVPSLVDE
490-560
EVKVAVIRDTLRLMDPLKKKRENQSQQLEKPFAGKEDALDGELTSAPDCNANPEAHLPSICLKQVFPKYA
560-630
KQFNYLRLVDRMANLFIRFLGIKGTMKLGPTGFRTFIRSCKLSSSSLSMAAVDILYIDITRRWNSMTLDQ
630-700
RDSGMCLQAFVEAFFFLAQRKFKMLPLHEQVASLIDLCEYHLSLLDEKRLVCGRGVPSGGRPPHRGPPQE
700-770
PSPSAQPAGDNPPPRTSCANKLSHPRHTLS
770-800
MAAAASVTGRVTWAASPMRSLGLGRRLSLPGPRLDAVTAAVNPSLSDHGNGLGRGTRGSGCSGGSLVADWGGGAAAAAAVALALAPALSTMRRGSSESELAARWEAEAVAAAKAAAKAEAEATAETVAEQVRVDAGAAGEPECKAGEEQPKVLAPAPAQPSAAEEGNTQVLQRPPPTLPPSKPKPVQGLCPHGKPRDKGRSCKRSSGHGSGENGSQRPVTVDSSKARTSLDALKISIRQLKWKEFPFGRRLPCDIYWHGVSFHDNDIFSGQVNKFPGMTEMVRKITLSRAVRTMQNLFPEEYNFYPRSWILPDEFQLFVAQVQMVKDDDPSWKPTFIVKPDGGCQGDGIYLIKDPSDIRLAGTLQSRPAVVQEYICKPLLIDKLKFDIRLYVLLKSLDPLEIYIAKDGLSRFCTEPYQEPTPKNLHRIFMHLTNYSLNIHSGNFIHSDSASTGSKRTFSSILCRLSSKGVDIKKVWSDIISVVIKTVIALTPELKVFYQSDIPTGRPGPTCFQILGFDILLMKNLKPILLEVNANPSMRIEHEHELSPGVFENVPSLVDEEVKVAVIRDTLRLMDPLKKKRENQSQQLEKPFAGKEDALDGELTSAPDCNANPEAHLPSICLKQVFPKYAKQFNYLRLVDRMANLFIRFLGIKGTMKLGPTGFRTFIRSCKLSSSSLSMAAVDILYIDITRRWNSMTLDQRDSGMCLQAFVEAFFFLAQRKFKMLPLHEQVASLIDLCEYHLSLLDEKRLVCGRGVPSGGRPPHRGPPQEPSPSAQPAGDNPPPRTSCANKLSHPRHTLS