You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
OR52N1
Olfactory receptor 52N1

Protein Summary
Description
Odorant receptor. Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000317078
  • ENSP00000322823
  • ENSG00000181001
  • ENST00000641645
  • ENSP00000493272

Symbol
  • OR11-61
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell line
0.53
tissue sample
0.43
cell type or tissue
0.37
pathway
0.32
molecular function
0.28


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 55   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 55   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (6)
G alpha (s) signalling events (R-HSA-418555)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
G alpha (s) signalling events
Reactome
GPCR downstream signalling
Reactome
Olfactory Signaling Pathway
Reactome
Signal Transduction
Reactome
Signaling by GPCR
Name
Explore in Pharos
Explore in Source
G alpha (s) signalling events
GPCR downstream signalling
Olfactory Signaling Pathway
Signal Transduction
Signaling by GPCR
Protein-Protein Interactions (23)
1 – 10 of 23
GNAL
Tbio
Novelty: 0.0277957
Score: 0.903
Data Source: STRINGDB
GNB1
Tbio
Novelty: 0.04716243
Score: 0.902
Data Source: STRINGDB
REEP5
Tbio
Novelty: 0.00356586
Score: 0.902
Data Source: STRINGDB
RTP3
Tbio
Novelty: 0.12230635
Score: 0.902
Data Source: STRINGDB
REEP1
Tbio
Novelty: 0.02999447
Score: 0.901
Data Source: STRINGDB
RTP2
Tbio
Novelty: 0.13129103
Score: 0.901
Data Source: STRINGDB
REEP4
Tbio
Novelty: 0.34354551
Score: 0.9
Data Source: STRINGDB
RTP1
Tbio
Novelty: 0.04761905
Score: 0.9
Data Source: STRINGDB
REEP2
Tdark
Novelty: 0.28121006
Score: 0.9
Data Source: STRINGDB
REEP3
Tbio
Novelty: 0.28483354
Score: 0.9
Data Source: STRINGDB
Publication Statistics
Patents
Amino Acid Sequence
Residue Counts
Sequence
MSFLNGTSLTPASFILNGIPGLEDVHLWISFPLCTMYSIAITGNFGLMYLIYCDEALHRPMYVFLALLSF
1-70
TDVLMCTSTLPNTLFILWFNLKEIDFKACLAQMFFVHTFTGMESGVLMLMALDHCVAICFPLRYATILTN
70-140
SVIAKAGFLTFLRGVMLVIPSTFLTKRLPYCKGNVIPHTYCDHMSVAKISCGNVRVNAIYGLIVALLIGG
140-210
FDILCITISYTMILQAVVSLSSADARQKAFSTCTAHFCAIVLTYVPAFFTFFTHHFGGHTIPLHIHIIMA
210-280
NLYLLMPPTMNPIVYGVKTRQVRESVIRFFLKGKDNSHNF
280-320
MSFLNGTSLTPASFILNGIPGLEDVHLWISFPLCTMYSIAITGNFGLMYLIYCDEALHRPMYVFLALLSFTDVLMCTSTLPNTLFILWFNLKEIDFKACLAQMFFVHTFTGMESGVLMLMALDHCVAICFPLRYATILTNSVIAKAGFLTFLRGVMLVIPSTFLTKRLPYCKGNVIPHTYCDHMSVAKISCGNVRVNAIYGLIVALLIGGFDILCITISYTMILQAVVSLSSADARQKAFSTCTAHFCAIVLTYVPAFFTFFTHHFGGHTIPLHIHIIMANLYLLMPPTMNPIVYGVKTRQVRESVIRFFLKGKDNSHNF