You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
STEAP2
Metalloreductase STEAP2

Protein Summary
Description
Metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). Uses NAD(+) as acceptor (By similarity). This gene is a member of the STEAP family and encodes a multi-pass membrane protein that localizes to the Golgi complex, the plasma membrane, and the vesicular tubular structures in the cytosol. A highly similar protein in mouse has both ferrireductase and cupric reductase activity, and stimulates the cellular uptake of both iron and copper in vitro. Increased transcriptional expression of the human gene is associated with prostate cancer progression. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000287908
  • ENSP00000287908
  • ENSG00000157214
  • ENST00000394621
  • ENSP00000378119
  • ENST00000394622
  • ENSP00000378120
  • ENST00000394626
  • ENSP00000378123
  • ENST00000394629
  • ENSP00000378125
  • ENST00000394632
  • ENSP00000378128

Symbol
  • PCANAP1
  • STAMP1
  • STMP
  • IPCA1
  • PUMPCn
  • STAMP1
  • PCANAP1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.8
kinase perturbation
0.76
PubMedID
0.71
microRNA
0.69
histone modification site profile
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 69.11   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 198   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 69.11   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 198   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (5)
Iron uptake and transport (R-HSA-917937)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Iron uptake and transport
Reactome
Transferrin endocytosis and recycling
Reactome
Transport of small molecules
Name
Explore in Pharos
Explore in Source
Iron uptake and transport
Transferrin endocytosis and recycling
Transport of small molecules
Protein-Protein Interactions (46)
1 – 10 of 46
SLC9A3R2
Tbio
Family: Transporter
Novelty: 0.01296563
p_int: 0.999784243
p_ni: 9.33e-7
p_wrong: 0.000214824
Data Source: BioPlex
VSTM1
Tbio
Novelty: 0.08843036
p_int: 0.999757714
p_ni: 0.000021492
p_wrong: 0.000220794
Data Source: BioPlex
DPEP1
Tclin
Family: Enzyme
Novelty: 0.0033193
p_int: 0.999265197
p_ni: 0.000004985
p_wrong: 0.000729819
Data Source: BioPlex
ZPLD1
Tbio
Novelty: 0.43373494
p_int: 0.911748057
p_ni: 0.00002589
p_wrong: 0.088226053
Score: 0.282
Data Source: BioPlex,STRINGDB
STEAP1
Tbio
Family: Enzyme
Novelty: 0.01938228
Score: 0.836
Data Source: STRINGDB
EEA1
Tbio
Novelty: 0.0045583
Score: 0.712
Data Source: STRINGDB
CYBRD1
Tbio
Family: Enzyme
Novelty: 0.01416785
Score: 0.686
Data Source: STRINGDB
TMEM52
Tdark
Score: 0.681
Data Source: STRINGDB
TRIAP1
Tbio
Novelty: 0.00396626
Score: 0.649
Data Source: STRINGDB
SINHCAF
Tdark
Novelty: 0.25139665
Score: 0.646
Data Source: STRINGDB
Publication Statistics
PubMed Score  69.11

PubMed score by year
PubTator Score  16.7

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MESISMMGSPKSLSETFLPNGINGIKDARKVTVGVIGSGDFAKSLTIRLIRCGYHVVIGSRNPKFASEFF
1-70
PHVVDVTHHEDALTKTNIIFVAIHREHYTSLWDLRHLLVGKILIDVSNNMRINQYPESNAEYLASLFPDS
70-140
LIVKGFNVVSAWALQLGPKDASRQVYICSNNIQARQQVIELARQLNFIPIDLGSLSSAREIENLPLRLFT
140-210
LWRGPVVVAISLATFFFLYSFVRDVIHPYARNQQSDFYKIPIEIVNKTLPIVAITLLSLVYLAGLLAAAY
210-280
QLYYGTKYRRFPPWLETWLQCRKQLGLLSFFFAMVHVAYSLCLPMRRSERYLFLNMAYQQVHANIENSWN
280-350
EEEVWRIEMYISFGIMSLGLLSLLAVTSIPSVSNALNWREFSFIQSTLGYVALLISTFHVLIYGWKRAFE
350-420
EEYYRFYTPPNFVLALVLPSIVILGKIILFLPCISRKLKRIKKGWEKSQFLEEGMGGTIPHVSPERVTVM
420-490
MESISMMGSPKSLSETFLPNGINGIKDARKVTVGVIGSGDFAKSLTIRLIRCGYHVVIGSRNPKFASEFFPHVVDVTHHEDALTKTNIIFVAIHREHYTSLWDLRHLLVGKILIDVSNNMRINQYPESNAEYLASLFPDSLIVKGFNVVSAWALQLGPKDASRQVYICSNNIQARQQVIELARQLNFIPIDLGSLSSAREIENLPLRLFTLWRGPVVVAISLATFFFLYSFVRDVIHPYARNQQSDFYKIPIEIVNKTLPIVAITLLSLVYLAGLLAAAYQLYYGTKYRRFPPWLETWLQCRKQLGLLSFFFAMVHVAYSLCLPMRRSERYLFLNMAYQQVHANIENSWNEEEVWRIEMYISFGIMSLGLLSLLAVTSIPSVSNALNWREFSFIQSTLGYVALLISTFHVLIYGWKRAFEEEYYRFYTPPNFVLALVLPSIVILGKIILFLPCISRKLKRIKKGWEKSQFLEEGMGGTIPHVSPERVTVM