You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ADCY4
Adenylate cyclase type 4

Protein Summary
Description
Catalyzes the formation of the signaling molecule cAMP in response to G-protein signaling. This gene encodes a member of the family of adenylate cyclases, which are membrane-associated enzymes that catalyze the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). Mouse studies show that adenylate cyclase 4, along with adenylate cyclases 2 and 3, is expressed in olfactory cilia, suggesting that several different adenylate cyclases may couple to olfactory receptors and that there may be multiple receptor-mediated mechanisms for the generation of cAMP signals. Alternative splicing results in transcript variants. [provided by RefSeq, Nov 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000310677
  • ENSP00000312126
  • ENSG00000129467
  • ENST00000418030
  • ENSP00000393177
  • ENST00000554068
  • ENSP00000452250
  • ENST00000642645
  • ENSP00000495316
  • ENSG00000284814
  • ENST00000644961
  • ENSP00000494454
  • ENST00000646612
  • ENSP00000494977

Symbol
  • AC4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.95
molecular function
0.91
pathway
0.73
tissue sample
0.62
PubMedID
0.59


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 152.58   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 211   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 152.58   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 211   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (105)
Activation of GABAB receptors (R-HSA-991365)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 33
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of GABAB receptors
Reactome
Adenylate cyclase activating pathway
Reactome
Adenylate cyclase inhibitory pathway
Reactome
Aquaporin-mediated transport
Reactome
Ca-dependent events
Name
Explore in Pharos
Explore in Source
Activation of GABAB receptors
Adenylate cyclase activating pathway
Adenylate cyclase inhibitory pathway
Aquaporin-mediated transport
Ca-dependent events
Gene Ontology Terms (16)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (454)
1 – 10 of 454
DRD5
Tchem
Family: GPCR
Novelty: 0.00069435
Score: 0.958
Data Source: STRINGDB
DRD1
Tclin
Family: GPCR
Novelty: 0.0005535
Score: 0.957
Data Source: STRINGDB
DRD2
Tclin
Family: GPCR
Novelty: 0.00028344
Score: 0.954
Data Source: STRINGDB
GNAS
Tbio
Novelty: 0.00259764
Score: 0.951
Data Source: STRINGDB
GNAS
Tbio
Novelty: 0.00259764
Score: 0.951
Data Source: STRINGDB
GNAS
Tbio
Novelty: 0.00259764
Score: 0.951
Data Source: STRINGDB
GNAS
Tbio
Novelty: 0.00259764
Score: 0.951
Data Source: STRINGDB
GNAL
Tbio
Novelty: 0.0277957
Score: 0.95
Data Source: STRINGDB
GCG
Tchem
Novelty: 0.00005614
Score: 0.945
Data Source: STRINGDB
PRKAR2B
Tbio
Family: Enzyme
Novelty: 0.00534149
Score: 0.945
Data Source: STRINGDB
Publication Statistics
PubMed Score  152.58

PubMed score by year
PubTator Score  55.87

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLGIVLCALAALLAVAWASGRELTSDPSFLTTVLCALG
1-70
GFSLLLGLASREQRLQRWTRPLSGLVWVALLALGHAFLFTGGVVSAWDQVSYFLFVIFTAYAMLPLGMRD
70-140
AAVAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVLFLCGNVAGVYHKALMERALRATFREALSSL
140-210
HSRRRLDTEKKHQEHLLLSILPAYLAREMKAEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIV
210-280
GFTRLASECSPKELVLMLNELFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCR
280-350
AIRKLRAATGVDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
350-420
AYAVEDAGMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGLKMRPSLLMTRYLESWGAAKP
420-490
FAHLSHGDSPVSTSTPLPEKTLASFSTQWSLDRSRTPRGLDDELDTGDAKFFQVIEQLNSQKQWKQSKDF
490-560
NPLTLYFREKEMEKEYRLSAIPAFKYYEACTFLVFLSNFIIQMLVTNRPPALAITYSITFLLFLLILFVC
560-630
FSEDLMRCVLKGPKMLHWLPALSGLVATRPGLRIALGTATILLVFAMAITSLFFFPTSSDCPFQAPNVSS
630-700
MISNLSWELPGSLPLISVPYSMHCCTLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSECLI
700-770
VRLYLGPLDSRPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRL
770-840
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLNEIIADFD
840-910
ELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMVEFAVALGSKLDVINKHSFNN
910-980
FRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETAWALQSLGYTCYSRGVIK
980-1050
VKGKGQLCTYFLNTDLTRTGPPSATLG
1050-1077
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLGIVLCALAALLAVAWASGRELTSDPSFLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWVALLALGHAFLFTGGVVSAWDQVSYFLFVIFTAYAMLPLGMRDAAVAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVLFLCGNVAGVYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMKAEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNELFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATGVDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAGAYAVEDAGMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGLKMRPSLLMTRYLESWGAAKPFAHLSHGDSPVSTSTPLPEKTLASFSTQWSLDRSRTPRGLDDELDTGDAKFFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSAIPAFKYYEACTFLVFLSNFIIQMLVTNRPPALAITYSITFLLFLLILFVCFSEDLMRCVLKGPKMLHWLPALSGLVATRPGLRIALGTATILLVFAMAITSLFFFPTSSDCPFQAPNVSSMISNLSWELPGSLPLISVPYSMHCCTLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSECLIVRLYLGPLDSRPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRLLLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMVEFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETAWALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGPPSATLG