You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LPCAT1
Lysophosphatidylcholine acyltransferase 1

Protein Summary
Description
Possesses both acyltransferase and acetyltransferase activities (PubMed:16864775, PubMed:21498505). Activity is calcium-independent (By similarity). Mediates the conversion of 1-acyl-sn-glycero-3-phosphocholine (LPC) into phosphatidylcholine (PC) (PubMed:21498505). Displays a clear preference for saturated fatty acyl-CoAs, and 1-myristoyl or 1-palmitoyl LPC as acyl donors and acceptors, respectively (PubMed:16704971). May synthesize phosphatidylcholine in pulmonary surfactant, thereby playing a pivotal role in respiratory physiology (PubMed:16864775). Involved in the regulation of lipid droplet number and size (PubMed:25491198). This gene encodes a member of the 1-acyl-sn-glycerol-3-phosphate acyltransferase family of proteins. The encoded enzyme plays a role in phospholipid metabolism, specifically in the conversion of lysophosphatidylcholine to phosphatidylcholine in the presence of acyl-CoA. This process is important in the synthesis of lung surfactant and platelet-activating factor ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000283415
  • ENSP00000283415
  • ENSG00000153395
  • ENST00000475622
  • ENSP00000423472

Symbol
  • AYTL2
  • PFAAP3
  • AYTL2
  • lpcat
  • AGPAT9
  • PFAAP3
  • AGPAT10
  • LPCAT-1
  • lysoPAFAT
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.95
transcription factor perturbation
0.88
metabolite
0.81
interacting protein
0.8
disease perturbation
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 58.93   (req: < 5)
Gene RIFs: 16   (req: <= 3)
Antibodies: 202   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 58.93   (req: >= 5)
Gene RIFs: 16   (req: > 3)
Antibodies: 202   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 17
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (15)
Acyl chain remodelling of PC (R-HSA-1482788)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 11
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Acyl chain remodelling of PC
Reactome
Acyl chain remodelling of PG
Reactome
Glycerophospholipid biosynthesis
Reactome
Immune System
Reactome
Innate Immune System
Name
Explore in Pharos
Explore in Source
Acyl chain remodelling of PC
Acyl chain remodelling of PG
Glycerophospholipid biosynthesis
Immune System
Innate Immune System
Gene Ontology Terms (26)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (166)
1 – 10 of 166
SLC27A2
Tbio
Family: Transporter
Novelty: 0.01635728
p_int: 0.96240508
p_ni: 0.037594919
Score: 0.365
Data Source: BioPlex,STRINGDB
MSTO1
Tbio
Novelty: 0.01471645
p_int: 0.954829155
p_ni: 0.045170162
p_wrong: 6.83e-7
Score: 0.222
Data Source: BioPlex,STRINGDB
MTR
Tbio
Family: Enzyme
Novelty: 0.00105146
p_int: 0.77719851
p_ni: 0.22280149
Score: 0.332
Data Source: BioPlex,STRINGDB
DIP2A
Tbio
Novelty: 0.1613013
p_int: 0.766310096
p_ni: 0.233689903
Score: 0.27
Data Source: BioPlex,STRINGDB
CHPT1
Tbio
Family: Enzyme
Novelty: 0.03546698
Score: 0.971
Data Source: STRINGDB
LPCAT3
Tbio
Family: Enzyme
Novelty: 0.00564842
Score: 0.964
Data Source: STRINGDB
STARD10
Tbio
Novelty: 0.1520699
Score: 0.944
Data Source: Reactome,STRINGDB
CEPT1
Tbio
Family: Enzyme
Novelty: 0.02109745
Score: 0.934
Data Source: STRINGDB
CRLS1
Tbio
Family: Enzyme
Novelty: 0.0900878
Score: 0.933
Data Source: STRINGDB
PEMT
Tbio
Family: Enzyme
Novelty: 0.01013987
Score: 0.926
Data Source: STRINGDB
Publication Statistics
PubMed Score  58.93

PubMed score by year
PubTator Score  52.6

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRLRGCGPRAAPASSAGASDARLLAPPGRNPFVHELRLSALQKAQVALMTLTLFPVRLLVAAAMMLLAWP
1-70
LALVASLGSAEKEPEQPPALWRKVVDFLLKAIMRTMWFAGGFHRVAVKGRQALPTEAAILTLAPHSSYFD
70-140
AIPVTMTMSSIVMKAESRDIPIWGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGT
140-210
CTNRTCLITFKPGAFIPGAPVQPVVLRYPNKLDTITWTWQGPGALEILWLTLCQFHNQVEIEFLPVYSPS
210-280
EEEKRNPALYASNVRRVMAEALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEK
280-350
DLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSVVCRPARTLDT
350-420
IQLAFKMYGAQEDGSVGEGDLSCILKTALGVAELTVTDLFRAIDQEEKGKITFADFHRFAEMYPAFAEEY
420-490
LYPDQTHFESCAETSPAPIPNGFCADFSPENSDAGRKPVRKKLD
490-534
MRLRGCGPRAAPASSAGASDARLLAPPGRNPFVHELRLSALQKAQVALMTLTLFPVRLLVAAAMMLLAWPLALVASLGSAEKEPEQPPALWRKVVDFLLKAIMRTMWFAGGFHRVAVKGRQALPTEAAILTLAPHSSYFDAIPVTMTMSSIVMKAESRDIPIWGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGAPVQPVVLRYPNKLDTITWTWQGPGALEILWLTLCQFHNQVEIEFLPVYSPSEEEKRNPALYASNVRRVMAEALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSVVCRPARTLDTIQLAFKMYGAQEDGSVGEGDLSCILKTALGVAELTVTDLFRAIDQEEKGKITFADFHRFAEMYPAFAEEYLYPDQTHFESCAETSPAPIPNGFCADFSPENSDAGRKPVRKKLD