You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ABCF1
ATP-binding cassette sub-family F member 1

Protein Summary
Description
Isoform 2 is required for efficient Cap- and IRES-mediated mRNA translation initiation. Isoform 2 is not involved in the ribosome biogenesis. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the GCN20 subfamily. Unlike other members of the superfamily, this protein lacks the transmembrane domains which are characteristic of most ABC transporters. This protein may be regulated by tumor necrosis factor-alpha and play a role in enhancement of protein synthesis and the inflammation process. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000326195
  • ENSP00000313603
  • ENSG00000204574
  • ENST00000376545
  • ENSP00000365728
  • ENST00000383587
  • ENSP00000373081
  • ENSG00000206490
  • ENST00000383588
  • ENSP00000373082
  • ENST00000412443
  • ENSP00000404726
  • ENSG00000236342
  • ENST00000419893
  • ENSP00000389065
  • ENSG00000232169
  • ENST00000420257
  • ENSP00000391102
  • ENSG00000225989
  • ENST00000421042
  • ENSP00000393143
  • ENSG00000231129
  • ENST00000423247
  • ENSP00000411327
  • ENST00000426219
  • ENSP00000414373
  • ENST00000448939
  • ENSP00000403526
  • ENST00000452530
  • ENSP00000389472
  • ENSG00000236149
  • ENST00000457078
  • ENSP00000412553
  • ENST00000457111
  • ENSP00000413319

Symbol
  • ABC50
  • ABC27
  • ABC50
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
drug perturbation
1
interacting protein
0.99
molecular function
0.96
kinase perturbation
0.93


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 19.21   (req: < 5)
Gene RIFs: 14   (req: <= 3)
Antibodies: 269   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 19.21   (req: >= 5)
Gene RIFs: 14   (req: > 3)
Antibodies: 269   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (2)
ABC-family proteins mediated transport (R-HSA-382556)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 2 of 2
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
ABC-family proteins mediated transport
Reactome
Transport of small molecules
Name
Explore in Pharos
Explore in Source
ABC-family proteins mediated transport
Transport of small molecules
Gene Ontology Terms (18)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (101)
1 – 10 of 101
CDC5L
Tbio
Family: TF
Novelty: 0.00617757
Score: 0.983
Data Source: STRINGDB
ABCE1
Tbio
Family: Transporter
Novelty: 0.00508003
Score: 0.956
Data Source: STRINGDB
EIF2S2
Tbio
Novelty: 0.017562
Score: 0.951
Data Source: Reactome,STRINGDB
RPS28
Tbio
Novelty: 0.04810298
Score: 0.948
Data Source: STRINGDB
RPL11
Tbio
Novelty: 0.00566877
Score: 0.947
Data Source: STRINGDB
RPL10A
Tbio
Novelty: 0.02288439
Score: 0.943
Data Source: STRINGDB
EIF2S1
Tbio
Novelty: 0.00157698
Score: 0.932
Data Source: Reactome,STRINGDB
RPS23
Tbio
Novelty: 0.0085808
Score: 0.925
Data Source: STRINGDB
DHX9
Tbio
Family: Enzyme
Novelty: 0.00143599
Score: 0.924
Data Source: STRINGDB
RPL8
Tbio
Novelty: 0.03315002
Score: 0.915
Data Source: STRINGDB
Publication Statistics
PubMed Score  19.21

PubMed score by year
PubTator Score  19.01

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPKAPKQQPPEPEWIGDGESTSPSDKVVKKGKKDKKIKKTFFEELAVEDKQAGEEEKVLKEKEQQQQQQQ
1-70
QQQKKKRDTRKGRRKKDVDDDGEEKELMERLKKLSVPTSDEEDEVPAPKPRGGKKTKGGNVFAALIQDQS
70-140
EEEEEEEKHPPKPAKPEKNRINKAVSEEQQPALKGKKGKEEKSKGKAKPQNKFAALDNEEEDKEEEIIKE
140-210
KEPPKQGKEKAKKAEQGSEEEGEGEEEEEEGGESKADDPYAHLSKKEKKKLKKQMEYERQVASLKAANAA
210-280
ENDFSVSQAEMSSRQAMLENASDIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIA
280-350
NRALSIPPNIDVLLCEQEVVADETPAVQAVLRADTKRLKLLEEERRLQGQLEQGDDTAAERLEKVYEELR
350-420
ATGAAAAEAKARRILAGLGFDPEMQNRPTQKFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAVIWL
420-490
NNYLQGWRKTLLIVSHDQGFLDDVCTDIIHLDAQRLHYYRGNYMTFKKMYQQKQKELLKQYEKQEKKLKE
490-560
LKAGGKSTKQAEKQTKEALTRKQQKCRRKNQDEESQEAPELLKRPKEYTVRFTFPDPPPLSPPVLGLHGV
560-630
TFGYQGQKPLFKNLDFGIDMDSRICIVGPNGVGKSTLLLLLTGKLTPTHGEMRKNHRLKIGFFNQQYAEQ
630-700
LRMEETPTEYLQRGFNLPYQDARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPT
700-770
NNLDIESIDALGEAINEYKGAVIVVSHDARLITETNCQLWVVEEQSVSQIDGDFEDYKREVLEALGEVMV
770-840
SRPRE
840-845
MPKAPKQQPPEPEWIGDGESTSPSDKVVKKGKKDKKIKKTFFEELAVEDKQAGEEEKVLKEKEQQQQQQQQQQKKKRDTRKGRRKKDVDDDGEEKELMERLKKLSVPTSDEEDEVPAPKPRGGKKTKGGNVFAALIQDQSEEEEEEEKHPPKPAKPEKNRINKAVSEEQQPALKGKKGKEEKSKGKAKPQNKFAALDNEEEDKEEEIIKEKEPPKQGKEKAKKAEQGSEEEGEGEEEEEEGGESKADDPYAHLSKKEKKKLKKQMEYERQVASLKAANAAENDFSVSQAEMSSRQAMLENASDIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDVLLCEQEVVADETPAVQAVLRADTKRLKLLEEERRLQGQLEQGDDTAAERLEKVYEELRATGAAAAEAKARRILAGLGFDPEMQNRPTQKFSGGWRMRVSLARALFMEPTLLMLDEPTNHLDLNAVIWLNNYLQGWRKTLLIVSHDQGFLDDVCTDIIHLDAQRLHYYRGNYMTFKKMYQQKQKELLKQYEKQEKKLKELKAGGKSTKQAEKQTKEALTRKQQKCRRKNQDEESQEAPELLKRPKEYTVRFTFPDPPPLSPPVLGLHGVTFGYQGQKPLFKNLDFGIDMDSRICIVGPNGVGKSTLLLLLTGKLTPTHGEMRKNHRLKIGFFNQQYAEQLRMEETPTEYLQRGFNLPYQDARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPTNNLDIESIDALGEAINEYKGAVIVVSHDARLITETNCQLWVVEEQSVSQIDGDFEDYKREVLEALGEVMVSRPRE