You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
B3GALNT2
UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 2

Protein Summary
Description
Beta-1,3-N-acetylgalactosaminyltransferase that synthesizes a unique carbohydrate structure, GalNAc-beta-1-3GlcNAc, on N- and O-glycans. Has no galactose nor galactosaminyl transferase activity toward any acceptor substrate. Involved in alpha-dystroglycan (DAG1) glycosylation: acts coordinately with GTDC2/POMGnT2 to synthesize a GalNAc-beta3-GlcNAc-beta-terminus at the 4-position of protein O-mannose in the biosynthesis of the phosphorylated O-mannosyl trisaccharide (N-acetylgalactosamine-beta-3-N-acetylglucosamine-beta-4-(phosphate-6-)mannose), a carbohydrate structure present in alpha-dystroglycan, which is required for binding laminin G-like domain-containing extracellular proteins with high affinity. This gene encodes a member of the glycosyltransferase 31 family. The encoded protein synthesizes GalNAc:beta-1,3GlcNAc, a novel carbohydrate structure, on N- and O-glycans. Alternatively spliced transcript variants that encode different isoforms have been described. [provided by RefSeq ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000313984
  • ENSP00000315678
  • ENSG00000162885
  • ENST00000366600
  • ENSP00000355559
  • ENST00000635244
  • ENSP00000489219
  • ENSG00000282880
  • ENST00000635453
  • ENSP00000489342

Symbol
  • MDDGA11
  • B3GalNAc-T2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.94
transcription factor binding site profile
0.92
histone modification site profile
0.88
transcription factor perturbation
0.8
microRNA
0.71


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.19   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 105   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.19   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 105   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (6)
Metabolism of proteins (R-HSA-392499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of proteins
Reactome
O-linked glycosylation
Reactome
Post-translational protein modification
Name
Explore in Pharos
Explore in Source
Metabolism of proteins
O-linked glycosylation
Post-translational protein modification
Protein-Protein Interactions (45)
1 – 10 of 45
OS9
Tbio
Novelty: 0.01598375
p_int: 0.99837769
p_ni: 0.00162231
p_wrong: 1e-9
Score: 0.166
Data Source: BioPlex,STRINGDB
CHST8
Tbio
Family: Enzyme
Novelty: 0.03837088
p_int: 0.997527901
p_ni: 0.002472099
Score: 0.194
Data Source: BioPlex,STRINGDB
PARP16
Tbio
Family: Enzyme
Novelty: 0.02664352
p_int: 0.992806799
p_ni: 0.007193201
Score: 0.188
Data Source: BioPlex,STRINGDB
EIF2B2
Tbio
Novelty: 0.04147594
p_int: 0.922065259
p_ni: 0.07782797
p_wrong: 0.000106771
Score: 0.179
Data Source: BioPlex,STRINGDB
AMIGO1
Tbio
Novelty: 0.01866694
p_int: 0.819234015
p_ni: 0.180557789
p_wrong: 0.000208195
Data Source: BioPlex
GFRA3
Tbio
Novelty: 0.15388432
p_int: 0.818285543
p_ni: 0.181519436
p_wrong: 0.000195021
Data Source: BioPlex
YY1AP1
Tbio
Novelty: 0.11956161
p_int: 0.762471958
p_ni: 0.237509159
p_wrong: 0.000018883
Data Source: BioPlex
IDS
Tbio
Family: Enzyme
Novelty: 0.0090788
p_int: 0.758222383
p_ni: 0.241777604
p_wrong: 1.3e-8
Score: 0.351
Data Source: BioPlex,STRINGDB
TAZ
Tbio
Novelty: 0.00236739
p_int: 0.75012919
p_ni: 0.249865071
p_wrong: 0.000005739
Data Source: BioPlex
POMK
Tbio
Family: Kinase
Novelty: 0.1748393
Score: 0.991
Data Source: STRINGDB
Publication Statistics
PubMed Score  12.19

PubMed score by year
PubTator Score  7.1

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRNWLVLLCPCVLGAALHLWLRLRSPPPACASGAGPADQLALFPQWKSTHYDVVVGVLSARNNHELRNVI
1-70
RSTWMRHLLQHPTLSQRVLVKFIIGAHGCEVPVEDREDPYSCKLLNITNPVLNQEIEAFSLSEDTSSGLP
70-140
EDRVVSVSFRVLYPIVITSLGVFYDANDVGFQRNITVKLYQAEQEEALFIARFSPPSCGVQVNKLWYKPV
140-210
EQFILPESFEGTIVWESQDLHGLVSRNLHKVTVNDGGGVLRVITAGEGALPHEFLEGVEGVAGGFIYTIQ
210-280
EGDALLHNLHSRPQRLIDHIRNLHEEDALLKEESSIYDDIVFVDVVDTYRNVPAKLLNFYRWTVETTSFN
280-350
LLLKTDDDCYIDLEAVFNRIVQKNLDGPNFWWGNFRLNWAVDRTGKWQELEYPSPAYPAFACGSGYVISK
350-420
DIVKWLASNSGRLKTYQGEDVSMGIWMAAIGPKRYQDSLWLCEKTCETGMLSSPQYSPWELTELWKLKER
420-490
CGDPCRCQAR
490-500
MRNWLVLLCPCVLGAALHLWLRLRSPPPACASGAGPADQLALFPQWKSTHYDVVVGVLSARNNHELRNVIRSTWMRHLLQHPTLSQRVLVKFIIGAHGCEVPVEDREDPYSCKLLNITNPVLNQEIEAFSLSEDTSSGLPEDRVVSVSFRVLYPIVITSLGVFYDANDVGFQRNITVKLYQAEQEEALFIARFSPPSCGVQVNKLWYKPVEQFILPESFEGTIVWESQDLHGLVSRNLHKVTVNDGGGVLRVITAGEGALPHEFLEGVEGVAGGFIYTIQEGDALLHNLHSRPQRLIDHIRNLHEEDALLKEESSIYDDIVFVDVVDTYRNVPAKLLNFYRWTVETTSFNLLLKTDDDCYIDLEAVFNRIVQKNLDGPNFWWGNFRLNWAVDRTGKWQELEYPSPAYPAFACGSGYVISKDIVKWLASNSGRLKTYQGEDVSMGIWMAAIGPKRYQDSLWLCEKTCETGMLSSPQYSPWELTELWKLKERCGDPCRCQAR