You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SERBP1
Plasminogen activator inhibitor 1 RNA-binding protein

Protein Summary
Description
May play a role in the regulation of mRNA stability. Binds to the 3'-most 134 nt of the SERPINE1/PAI1 mRNA, a region which confers cyclic nucleotide regulation of message decay.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000361219
  • ENSP00000354591
  • ENSG00000142864
  • ENST00000370990
  • ENSP00000360029
  • ENST00000370994
  • ENSP00000360033
  • ENST00000370995
  • ENSP00000360034

Symbol
  • PAIRBP1
  • CGI-55
  • CHD3IP
  • HABP4L
  • PAIRBP1
  • PAI-RBP1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
1
kinase perturbation
1
disease perturbation
0.99
transcription factor perturbation
0.98
microRNA
0.96


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 19.62   (req: < 5)
Gene RIFs: 21   (req: <= 3)
Antibodies: 309   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 19.62   (req: >= 5)
Gene RIFs: 21   (req: > 3)
Antibodies: 309   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (5)
Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
Apoptosis-related network due to altered Notch3 in ovarian cancer
WikiPathways
Apoptosis-related network due to altered Notch3 in ovarian cancer
WikiPathways
Focal Adhesion-PI3K-Akt-mTOR-signaling pathway
WikiPathways
PI3K-Akt Signaling Pathway
WikiPathways
Regulatory circuits of the STAT3 signaling pathway
Name
Explore in Pharos
Explore in Source
Apoptosis-related network due to altered Notch3 in ovarian cancer
Apoptosis-related network due to altered Notch3 in ovarian cancer
Focal Adhesion-PI3K-Akt-mTOR-signaling pathway
PI3K-Akt Signaling Pathway
Regulatory circuits of the STAT3 signaling pathway
Gene Ontology Terms (12)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
HGNC
Inferred from High Throughput Direct Assay (HDA)
BHF-UCL
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Protein-Protein Interactions (197)
1 – 10 of 197
TBCE
Tbio
Novelty: 0.00382883
p_int: 0.998616923
p_ni: 0.001382919
p_wrong: 1.57e-7
Score: 0.636
Data Source: BioPlex,STRINGDB
SNRPC
Tbio
Novelty: 0.03157727
p_int: 0.866374352
p_ni: 0.133625649
Score: 0.212
Data Source: BioPlex,STRINGDB
SRSF2
Tbio
Novelty: 0.00273135
p_int: 0.863728871
p_ni: 0.136271129
Score: 0.311
Data Source: BioPlex,STRINGDB
RPL21
Tbio
Novelty: 0.02036348
Score: 0.977
Data Source: STRINGDB
RPS25
Tbio
Novelty: 0.01833381
Score: 0.974
Data Source: STRINGDB
RPL8
Tbio
Novelty: 0.03315002
Score: 0.973
Data Source: STRINGDB
RPL23
Tbio
Novelty: 0.02634055
Score: 0.972
Data Source: STRINGDB
RPS18
Tbio
Novelty: 0.01418961
Score: 0.972
Data Source: STRINGDB
RPL17
Tbio
Novelty: 0.06372809
Score: 0.972
Data Source: STRINGDB
RPS19
Tbio
Novelty: 0.0016302
Score: 0.972
Data Source: STRINGDB
Publication Statistics
PubMed Score  19.62

PubMed score by year
PubTator Score  18.45

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQL
1-70
RKESQKDRKNPLPPSVGVVDKKEETQPPVALKKEGIRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFEK
70-140
PLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSGSDRSSFSHYSGL
140-210
KHEDKRGGSGSHNWGTVKDELTESPKYIQKQISYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEV
210-280
KEEGPKEMTLDEWKAIQNKDRAKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPAND
280-350
ITSQLEINFGDLGRPGRGGRGGRGGRGRGGRPNRGSRTDKSSASAPDVDDPEAFPALA
350-408
MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQLRKESQKDRKNPLPPSVGVVDKKEETQPPVALKKEGIRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFEKPLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSGSDRSSFSHYSGLKHEDKRGGSGSHNWGTVKDELTESPKYIQKQISYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEMTLDEWKAIQNKDRAKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPANDITSQLEINFGDLGRPGRGGRGGRGGRGRGGRPNRGSRTDKSSASAPDVDDPEAFPALA