You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ZSCAN1
Zinc finger and SCAN domain-containing protein 1

Protein Summary
Description
May be involved in transcriptional regulation.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000282326
  • ENSP00000282326
  • ENSG00000152467

Symbol
  • MZF-1
  • ZNF915
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.85
cell type or tissue
0.73
cell line
0.6
molecular function
0.6
tissue
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 23.86   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 103   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 23.86   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 103   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (31)
1 – 10 of 31
ZSCAN18
Tdark
Family: TF
Novelty: 0.6628855
p_int: 0.999999934
p_ni: 6.5e-8
Score: 0.713
Data Source: BioPlex,STRINGDB
ZNF174
Tbio
Family: TF
Novelty: 0.0250976
p_int: 0.999997998
p_ni: 0.000002002
Score: 0.694
Data Source: BioPlex,STRINGDB
MZF1
Tbio
Family: TF
Novelty: 0.01240905
p_int: 0.999989833
p_ni: 6.1e-8
p_wrong: 0.000010107
Score: 0.563
Data Source: BioPlex,STRINGDB
ZNF24
Tbio
Family: TF
Novelty: 0.02958008
p_int: 0.999889941
p_ni: 0.000110059
Score: 0.645
Data Source: BioPlex,STRINGDB
PGBD1
Tbio
Novelty: 0.09970362
p_int: 0.999568601
p_ni: 0.00043131
p_wrong: 8.9e-8
Score: 0.828
Data Source: BioPlex,STRINGDB
ZNF213
Tdark
Family: TF
Novelty: 0.21686747
p_int: 0.999313177
p_ni: 0.000023923
p_wrong: 0.0006629
Score: 0.71
Data Source: BioPlex,STRINGDB
ZNF496
Tdark
Family: TF
Novelty: 0.2278481
p_int: 0.998255863
p_ni: 0.000255809
p_wrong: 0.001488328
Score: 0.205
Data Source: BioPlex,STRINGDB
ZSCAN25
Tdark
Family: TF
Novelty: 3.23076923
p_int: 0.806515756
p_ni: 0.19348424
p_wrong: 4e-9
Score: 0.499
Data Source: BioPlex,STRINGDB
GOLGA3
Tbio
Novelty: 0.04622539
p_int: 0.805108072
p_ni: 0.194891928
Score: 0.205
Data Source: BioPlex,STRINGDB
PRMT8
Tchem
Family: Epigenetic
Novelty: 0.05036347
p_int: 0.760942595
p_ni: 0.239057392
p_wrong: 1.3e-8
Score: 0.194
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  23.86

PubMed score by year
PubTator Score  0.17

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLPRPKAPASPRRPQTPTPSEQDADPGPASPRDTEAQRLRFRQFQYHVASGPHLALGQLWTLCRQWLRPE
1-70
ARSKEQMLELLVLEQFLGALPSKMRTWVQSQGPRSCREAASLVEDLTQMCQQEVLVSLDSVEPQDWSFGE
70-140
EEDGKSPRSQKEPSQASELILDAVAAAPALPEESEWLETTQLQQSLHTRAEAEAPRAPGLLGSRARLPLK
140-210
PSIWDEPEDLLAGPSSDLRAEGTVISSPKGPSAQRISPRRRNRNTDQSGRHQPSLKHTKGGTQEAVAGIS
210-280
VVPRGPRGGRPFQCADCGMVFTWVTHFIEHQKTHREEGPFPCPECGKVFLHNSVLTEHGKIHLLEPPRKK
280-350
APRSKGPRESVPPRDGAQGPVAPRSPKRPFQCSVCGKAFPWMVHLIDHQKLHTAHGHM
350-408
MLPRPKAPASPRRPQTPTPSEQDADPGPASPRDTEAQRLRFRQFQYHVASGPHLALGQLWTLCRQWLRPEARSKEQMLELLVLEQFLGALPSKMRTWVQSQGPRSCREAASLVEDLTQMCQQEVLVSLDSVEPQDWSFGEEEDGKSPRSQKEPSQASELILDAVAAAPALPEESEWLETTQLQQSLHTRAEAEAPRAPGLLGSRARLPLKPSIWDEPEDLLAGPSSDLRAEGTVISSPKGPSAQRISPRRRNRNTDQSGRHQPSLKHTKGGTQEAVAGISVVPRGPRGGRPFQCADCGMVFTWVTHFIEHQKTHREEGPFPCPECGKVFLHNSVLTEHGKIHLLEPPRKKAPRSKGPRESVPPRDGAQGPVAPRSPKRPFQCSVCGKAFPWMVHLIDHQKLHTAHGHM