You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
POC5
Centrosomal protein POC5

Protein Summary
Description
Essential for the assembly of the distal half of centrioles, required for centriole elongation.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000428202
  • ENSP00000410216
  • ENSG00000152359
  • ENST00000446329
  • ENSP00000399481
  • ENST00000510798
  • ENSP00000426796

Symbol
  • C5orf37
  • C5orf37
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.82
transcription factor
0.73
cell type or tissue
0.72
kinase perturbation
0.71
tissue sample
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7.23   (req: < 5)
Gene RIFs: 6   (req: <= 3)
Antibodies: 100   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7.23   (req: >= 5)
Gene RIFs: 6   (req: > 3)
Antibodies: 100   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (6)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
HPA
Inferred from Direct Assay (IDA)
HPA
Inferred from Direct Assay (IDA)
HPA
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Protein-Protein Interactions (88)
1 – 10 of 88
CETN1
Tbio
Novelty: 0.01870324
p_int: 1
Score: 0.673
Data Source: BioPlex,STRINGDB
FAM160B1
Tdark
Novelty: 0.38415331
p_int: 0.999770027
p_ni: 0.000229973
Score: 0.219
Data Source: BioPlex,STRINGDB
CETN2
Tbio
Novelty: 0.00991915
p_int: 0.997911265
p_ni: 0.002088735
Score: 0.783
Data Source: BioPlex,STRINGDB
HOOK2
Tbio
Novelty: 0.05566712
p_int: 0.997341566
p_ni: 0.002658387
p_wrong: 4.7e-8
Score: 0.304
Data Source: BioPlex,STRINGDB
CETN3
Tbio
Novelty: 0.0104296
p_int: 0.995446517
p_ni: 0.004553483
Score: 0.873
Data Source: BioPlex,STRINGDB
CALML3
Tbio
Novelty: 0.04654771
p_int: 0.99506014
p_ni: 0.004939713
p_wrong: 1.47e-7
Score: 0.156
Data Source: BioPlex,STRINGDB
CTSH
Tchem
Family: Enzyme
Novelty: 0.00380318
p_int: 0.987421248
p_ni: 0.011560449
p_wrong: 0.001018302
Score: 0.179
Data Source: BioPlex,STRINGDB
AARSD1
Tdark
Novelty: 1.1528945
p_int: 0.973286427
p_ni: 0.007282526
p_wrong: 0.019431047
Data Source: BioPlex
CALML5
Tbio
Novelty: 0.03997456
p_int: 0.960117542
p_ni: 0.039882455
p_wrong: 3e-9
Score: 0.159
Data Source: BioPlex,STRINGDB
GM2A
Tbio
Novelty: 0.0083165
p_int: 0.904031796
p_ni: 0.095968204
Score: 0.183
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  7.23

PubMed score by year
PubTator Score  5.19

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSSDEEKYSLPVVQNDSSRGSSVSSNLQEEYEELLHYAIVTPNIEPCASQSSHPKGELVPDVRISTIHDI
1-70
LHSQGNNSEVRETAIEVGKGCDFHISSHSKTDESSPVLSPRKPSHPVMDFFSSHLLADSSSPATNSSHTD
70-140
AHEILVSDFLVSDENLQKMENVLDLWSSGLKTNIISELSKWRLNFIDWHRMEMRKEKEKHAAHLKQLCNQ
140-210
INELKELQKTFEISIGRKDEVISSLSHAIGKQKEKIELMRTFFHWRIGHVRARQDVYEGKLADQYYQRTL
210-280
LKKVWKVWRSVVQKQWKDVVERACQARAEEVCIQISNDYEAKVAMLSGALENAKAEIQRMQHEKEHFEDS
280-350
MKKAFMRGVCALNLEAMTIFQNRNDAGIDSTNNKKEEYGPGVQGKEHSAHLDPSAPPMPLPVTSPLLPSP
350-420
PAAVGGASATAVPSAASMTSTRAASASSVHVPVSALGAGSAATAASEEMYVPRVVTSAQQKAGRTITARI
420-490
TGRCDFASKNRISSSLAIMGVSPPMSSVVVEKHHPVTVQTIPQATAAKYPRTIHPESSTSASRSLGTRSA
490-560
HTQSLTSVHSIKVVD
560-575
MSSDEEKYSLPVVQNDSSRGSSVSSNLQEEYEELLHYAIVTPNIEPCASQSSHPKGELVPDVRISTIHDILHSQGNNSEVRETAIEVGKGCDFHISSHSKTDESSPVLSPRKPSHPVMDFFSSHLLADSSSPATNSSHTDAHEILVSDFLVSDENLQKMENVLDLWSSGLKTNIISELSKWRLNFIDWHRMEMRKEKEKHAAHLKQLCNQINELKELQKTFEISIGRKDEVISSLSHAIGKQKEKIELMRTFFHWRIGHVRARQDVYEGKLADQYYQRTLLKKVWKVWRSVVQKQWKDVVERACQARAEEVCIQISNDYEAKVAMLSGALENAKAEIQRMQHEKEHFEDSMKKAFMRGVCALNLEAMTIFQNRNDAGIDSTNNKKEEYGPGVQGKEHSAHLDPSAPPMPLPVTSPLLPSPPAAVGGASATAVPSAASMTSTRAASASSVHVPVSALGAGSAATAASEEMYVPRVVTSAQQKAGRTITARITGRCDFASKNRISSSLAIMGVSPPMSSVVVEKHHPVTVQTIPQATAAKYPRTIHPESSTSASRSLGTRSAHTQSLTSVHSIKVVD