You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
IQUB
IQ and ubiquitin-like domain-containing protein

Protein Summary
Description
May play roles in cilia formation and/or maintenance.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000324698
  • ENSP00000324882
  • ENSG00000164675
  • ENST00000466202
  • ENSP00000417769
  • ENST00000484508
  • ENSP00000417285
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.83
gene perturbation
0.78
tissue
0.66
cell type or tissue
0.65
histone modification site profile
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 8.24   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 21   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 8.24   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 21   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (4)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (40)
1 – 10 of 40
TLR6
Tbio
Novelty: 0.00137513
p_int: 0.998579484
p_ni: 0.000064744
p_wrong: 0.001355771
Score: 0.688
Data Source: BioPlex,STRINGDB
BTBD1
Tbio
Novelty: 0.32684825
p_int: 0.966621894
p_ni: 0.033378102
p_wrong: 4e-9
Score: 0.189
Data Source: BioPlex,STRINGDB
ASB15
Tdark
Novelty: 0.22517162
Score: 0.784
Data Source: STRINGDB
FAM180A
Tdark
Novelty: 18
Score: 0.742
Data Source: STRINGDB
WDR91
Tbio
Novelty: 0.19313305
Score: 0.713
Data Source: STRINGDB
ARMC4
Tbio
Novelty: 0.22575052
Score: 0.708
Data Source: STRINGDB
SPEF2
Tdark
Novelty: 0.0493075
Score: 0.684
Data Source: STRINGDB
RSPH9
Tbio
Novelty: 0.12094399
Score: 0.678
Data Source: STRINGDB
FAM161A
Tbio
Novelty: 0.07384226
Score: 0.661
Data Source: STRINGDB
ENKUR
Tdark
Novelty: 0.28823058
Score: 0.64
Data Source: STRINGDB
Publication Statistics
PubMed Score  8.24

PubMed score by year
PubTator Score  0.51

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSNQQEKYEAQNIVNSTEESDDAFDTVTIPVPSEEPQESDQTEEHESGIEQFSESHAIHVEEQSDQSFSS
1-70
LEPDNEQLMEEVISPRQVSYTPQHHEKQYAMQRPNDDSLAFLDKIKSVKESLQESVEDSLATVKVVLIPV
70-140
GQEIVIPFKVDTILKYLKDHFSHLLGIPHSVLQIRYSGKILKNNETLVQHGVKPQEIVQVEIFSTNPDLY
140-210
PVRRIDGLTDVSQIITVTVQTGLDQYQQVPVEIVKSDFHKPFLGGFRHKVTGVEYHNAGTQTVPKRIPER
210-280
LSIFCRDTQTVFQKKNLQQTTNTTSTQMTNIGVYVSNMTDKLVTPGKYFSAAEYHAQRLKAVIVIQTYYR
280-350
QWHAKIFVENLRRQKSLRLEWETQQELRKIREKEEWIKLDYHRRHNPKTNEDFEFLYNALEFWRQEELTR
350-420
INQSFTGAERKAALCELLEKETQIIASIGRHRYIAYMANQEAAIQAFLDKCSAPKIWRTPNGKTIEMDTQ
420-490
FTIRARELQNIYKCIMLKNISQDERLDVLLTLKHTVKEHECKLTQEILELIDREVDLMMRGVKHHNLEGL
490-560
RKRIATLFFHYIKTPLFNPEVAKYLKVPQDPLKFYKKIYFCHSCQLYLPSTEFSVSSTSRRIYRCRNCIN
560-630
LQNEAQKRESFLKYKCLLQQLYYTEADYEDDSKIAFLMQLQDIQYLTENIWASQSVLSACDNLSDLVMVR
630-700
WNKSLEWSPWNCILLTKDEAAAHLKLTSIEEGYERSFIHKIKHKHILAKNYFSQVPVLASFILDDGEIDE
700-770
IRWKYHSDTTPKIIESQRPPH
770-791
MSNQQEKYEAQNIVNSTEESDDAFDTVTIPVPSEEPQESDQTEEHESGIEQFSESHAIHVEEQSDQSFSSLEPDNEQLMEEVISPRQVSYTPQHHEKQYAMQRPNDDSLAFLDKIKSVKESLQESVEDSLATVKVVLIPVGQEIVIPFKVDTILKYLKDHFSHLLGIPHSVLQIRYSGKILKNNETLVQHGVKPQEIVQVEIFSTNPDLYPVRRIDGLTDVSQIITVTVQTGLDQYQQVPVEIVKSDFHKPFLGGFRHKVTGVEYHNAGTQTVPKRIPERLSIFCRDTQTVFQKKNLQQTTNTTSTQMTNIGVYVSNMTDKLVTPGKYFSAAEYHAQRLKAVIVIQTYYRQWHAKIFVENLRRQKSLRLEWETQQELRKIREKEEWIKLDYHRRHNPKTNEDFEFLYNALEFWRQEELTRINQSFTGAERKAALCELLEKETQIIASIGRHRYIAYMANQEAAIQAFLDKCSAPKIWRTPNGKTIEMDTQFTIRARELQNIYKCIMLKNISQDERLDVLLTLKHTVKEHECKLTQEILELIDREVDLMMRGVKHHNLEGLRKRIATLFFHYIKTPLFNPEVAKYLKVPQDPLKFYKKIYFCHSCQLYLPSTEFSVSSTSRRIYRCRNCINLQNEAQKRESFLKYKCLLQQLYYTEADYEDDSKIAFLMQLQDIQYLTENIWASQSVLSACDNLSDLVMVRWNKSLEWSPWNCILLTKDEAAAHLKLTSIEEGYERSFIHKIKHKHILAKNYFSQVPVLASFILDDGEIDEIRWKYHSDTTPKIIESQRPPH