You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NAT8L
N-acetylaspartate synthetase

Protein Summary
Description
Plays a role in the regulation of lipogenesis by producing N-acetylaspartate acid (NAA), a brain-specific metabolite. NAA occurs in high concentration in brain and its hydrolysis plays a significant part in the maintenance of intact white matter. Promotes dopamine uptake by regulating TNF-alpha expression. Attenuates methamphetamine-induced inhibition of dopamine uptake. This gene encodes a single-pass membrane protein, which contains a conserved sequence of the GCN5 or NAT superfamily of N-acetyltransferases and is a member of the N-acyltransferase (NAT) superfamily. This protein is a neuron-specific protein and is the N-acetylaspartate (NAA) biosynthetic enzyme, catalyzing the NAA synthesis from L-aspartate and acetyl-CoA. NAA is a major storage and transport form of acetyl coenzyme A specific to the nervous system. The gene mutation results in primary NAA deficiency (hypoacetylaspartia). [provided by RefSeq, Dec 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000423729
  • ENSP00000413064
  • ENSG00000185818

Symbol
  • CML3
  • CML3
  • NACED
  • NAT8-LIKE
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.74
microRNA
0.61
cell type or tissue
0.52
cellular component
0.52
PubMedID
0.47


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 44.29   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 82   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 44.29   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 82   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Aspartate and asparagine metabolism (R-HSA-8963693)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Aspartate and asparagine metabolism
Reactome
Metabolism
Reactome
Metabolism of amino acids and derivatives
Name
Explore in Pharos
Explore in Source
Aspartate and asparagine metabolism
Metabolism
Metabolism of amino acids and derivatives
Gene Ontology Terms (8)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Protein-Protein Interactions (50)
1 – 10 of 50
TSPAN5
Tbio
Novelty: 0.13109854
p_int: 0.999996838
p_ni: 0.000003155
p_wrong: 7e-9
Score: 0.189
Data Source: BioPlex,STRINGDB
KIAA0232
Tdark
Novelty: 2
p_int: 0.914364068
p_ni: 0.061958119
p_wrong: 0.023677812
Score: 0.295
Data Source: BioPlex,STRINGDB
RIMKLA
Tdark
Family: Enzyme
Novelty: 1.30941704
Score: 0.972
Data Source: STRINGDB
RIMKLB
Tdark
Family: Enzyme
Novelty: 0.42975207
Score: 0.972
Data Source: STRINGDB
ASPA
Tbio
Family: Enzyme
Novelty: 0.00421309
Score: 0.935
Data Source: STRINGDB
FOLH1
Tchem
Family: Enzyme
Novelty: 0.00036064
Score: 0.922
Data Source: STRINGDB
GOT2
Tbio
Family: Enzyme
Novelty: 0.00062666
Score: 0.919
Data Source: STRINGDB
GOT1
Tbio
Family: Enzyme
Novelty: 0.00607491
Score: 0.918
Data Source: STRINGDB
ASS1
Tbio
Family: Enzyme
Novelty: 0.00451148
Score: 0.91
Data Source: STRINGDB
ASNS
Tchem
Family: Enzyme
Novelty: 0.00372649
Score: 0.908
Data Source: STRINGDB
Publication Statistics
PubMed Score  44.29

PubMed score by year
PubTator Score  18.46

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MHCGPPDMVCETKIVAAEDHEALPGAKKDALLAAAGAMWPPLPAAPGPAAAPPAPPPAPVAQPHGGAGGA
1-70
GPPGGRGVCIREFRAAEQEAARRIFYDGIMERIPNTAFRGLRQHPRAQLLYALLAALCFAVSRSLLLTCL
70-140
VPAALLGLRYYYSRKVIRAYLECALHTDMADIEQYYMKPPGSCFWVAVLDGNVVGIVAARAHEEDNTVEL
140-210
LRMSVDSRFRGKGIAKALGRKVLEFAVVHNYSAVVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTL
210-280
SLAERLFFQVRYHRYRLQLREE
280-302
MHCGPPDMVCETKIVAAEDHEALPGAKKDALLAAAGAMWPPLPAAPGPAAAPPAPPPAPVAQPHGGAGGAGPPGGRGVCIREFRAAEQEAARRIFYDGIMERIPNTAFRGLRQHPRAQLLYALLAALCFAVSRSLLLTCLVPAALLGLRYYYSRKVIRAYLECALHTDMADIEQYYMKPPGSCFWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRKVLEFAVVHNYSAVVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE