You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
ZNF491
Zinc finger protein 491

Protein Summary
Description
May be involved in transcriptional regulation.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000323169
  • ENSP00000313443
  • ENSG00000177599
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
microRNA
0.82
histone modification site profile
0.7
cell line
0.58
tissue
0.53
cell type or tissue
0.48


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 41   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 41   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (17)
1 – 10 of 17
BPIFA2
Tbio
Novelty: 0.01712357
p_int: 0.999984291
p_ni: 0.000015653
p_wrong: 5.6e-8
Score: 0.188
Data Source: BioPlex,STRINGDB
IGHA2
Tbio
p_int: 0.999955661
p_ni: 0.000043943
p_wrong: 3.95e-7
Data Source: BioPlex
MUC7
Tbio
Novelty: 0.00971879
p_int: 0.999871982
p_ni: 0.000047766
p_wrong: 0.000080252
Score: 0.188
Data Source: BioPlex,STRINGDB
CST2
Tbio
Novelty: 0.03317401
p_int: 0.999759023
p_ni: 0.000240589
p_wrong: 3.89e-7
Score: 0.165
Data Source: BioPlex,STRINGDB
JCHAIN
Tbio
Novelty: 0.00213004
p_int: 0.997020564
p_ni: 0.000957674
p_wrong: 0.002021762
Score: 0.181
Data Source: BioPlex,STRINGDB
PIGR
Tbio
Novelty: 0.00308738
p_int: 0.995785599
p_ni: 0.004214362
p_wrong: 3.9e-8
Score: 0.175
Data Source: BioPlex,STRINGDB
CST4
Tbio
Novelty: 0.010423
p_int: 0.994953011
p_ni: 0.005046962
p_wrong: 2.8e-8
Data Source: BioPlex
ZG16B
Tbio
Novelty: 0.08523566
p_int: 0.991443403
p_ni: 0.00855653
p_wrong: 6.7e-8
Data Source: BioPlex
IGHA1
Tbio
p_int: 0.989086747
p_ni: 0.010913252
p_wrong: 1e-9
Data Source: BioPlex
HIST2H2AB
Tdark
Novelty: 0.26837061
p_int: 0.972788213
p_ni: 0.027195226
p_wrong: 0.000016562
Score: 0.17
Data Source: BioPlex,STRINGDB
Publication Statistics
Amino Acid Sequence
Residue Counts
Sequence
MGERLFESAEGSQCGETFTQVPEDMLNKKTLPGVKSCESGTCGEIFMGYSSFNRNIRTDTGHQPHKCQKF
1-70
LEKPYKHKQRRKALSHSHCFRTHERPHTREKPFDCKECEKSFISPASIRRYMVTHSGDGPYKCKFCGKAL
70-140
DCLSLYLTHERTHTGEKRYECKQCGKAFSWHSSVRIHERTHTGEKPYECKECGKSFNFSSSFRRHERTHT
140-210
GEKPYKCKECGKAFNCPSSFHRHERTHTGEKPYECKLYGKALSRLISFRRHMRMHTGERPHKCKICGKAF
210-280
YSPSSFQRHERSHTGEKPYKCKQCGKAFTCSTSFQYHERTHTGEKPDGCKQCGKAFRSAKYIRIHGRTHT
280-350
GEKPYECKQCGKAFHCVSSFHRHERTHAGEKPYECKHCGKAFTCSIYIRIHERIHTGEKPYQCKECGKAF
350-420
IRSSYCRKHERTHTINI
420-437
MGERLFESAEGSQCGETFTQVPEDMLNKKTLPGVKSCESGTCGEIFMGYSSFNRNIRTDTGHQPHKCQKFLEKPYKHKQRRKALSHSHCFRTHERPHTREKPFDCKECEKSFISPASIRRYMVTHSGDGPYKCKFCGKALDCLSLYLTHERTHTGEKRYECKQCGKAFSWHSSVRIHERTHTGEKPYECKECGKSFNFSSSFRRHERTHTGEKPYKCKECGKAFNCPSSFHRHERTHTGEKPYECKLYGKALSRLISFRRHMRMHTGERPHKCKICGKAFYSPSSFQRHERSHTGEKPYKCKQCGKAFTCSTSFQYHERTHTGEKPDGCKQCGKAFRSAKYIRIHGRTHTGEKPYECKQCGKAFHCVSSFHRHERTHAGEKPYECKHCGKAFTCSIYIRIHERIHTGEKPYQCKECGKAFIRSSYCRKHERTHTINI