You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
SIRT6
NAD-dependent protein deacetylase sirtuin-6

Protein Summary
Description
NAD-dependent protein deacetylase. Has deacetylase activity towards histone H3K9Ac and H3K56Ac. Modulates acetylation of histone H3 in telomeric chromatin during the S-phase of the cell cycle. Deacetylates histone H3K9Ac at NF-kappa-B target promoters and may down-regulate the expression of a subset of NF-kappa-B target genes. Acts as a corepressor of the transcription factor HIF1A to control the expression of multiple glycolytic genes to regulate glucose homeostasis. Required for genomic stability. Regulates the production of TNF protein. Has a role in the regulation of life span (By similarity). Deacetylation of nucleosomes interferes with RELA binding to target DNA. May be required for the association of WRN with telomeres during S-phase and for normal telomere maintenance. Required for genomic stability. Required for normal IGF1 serum levels and normal glucose homeostasis. Modulates cellular senescence and apoptosis. On DNA damage, promotes DNA end resection via deacetylation of RB ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000305232
  • ENSP00000305310
  • ENSG00000077463
  • ENST00000337491
  • ENSP00000337332

Symbol
  • SIR2L6
  • SIR2L6
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.98
histone modification site profile
0.78
cellular component
0.73
biological term
0.71
phenotype
0.71


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 575.96   (req: < 5)
Gene RIFs: 143   (req: <= 3)
Antibodies: 615   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 575.96   (req: >= 5)
Gene RIFs: 143   (req: > 3)
Antibodies: 615   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 29
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 2
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (9)
1 – 5 of 9
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (23)
DNA Double-Strand Break Repair (R-HSA-5693532)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
DNA Double-Strand Break Repair
Reactome
DNA Repair
Reactome
HDR through Homologous Recombination (HRR) or Single Strand Annealing (SSA)
Reactome
Homology Directed Repair
Reactome
Pre-NOTCH Expression and Processing
Name
Explore in Pharos
Explore in Source
DNA Double-Strand Break Repair
DNA Repair
HDR through Homologous Recombination (HRR) or Single Strand Annealing (SSA)
Homology Directed Repair
Pre-NOTCH Expression and Processing
Gene Ontology Terms (33)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Traceable Author Statement (TAS)
BHF-UCL
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (264)
1 – 10 of 264
TUBB1
Tclin
Novelty: 0.05351568
p_int: 0.999958143
p_ni: 0.000041857
Data Source: BioPlex
FAT4
Tbio
Novelty: 0.01665267
p_int: 0.999950685
p_ni: 0.000049315
Data Source: BioPlex
FAT3
Tbio
Novelty: 0.02603864
p_int: 0.999884075
p_ni: 0.000115925
Data Source: BioPlex
CELSR2
Tbio
Family: GPCR
Novelty: 0.05277584
p_int: 0.999725945
p_ni: 0.000274055
Data Source: BioPlex
ZNF318
Tbio
Novelty: 0.04010695
p_int: 0.999686777
p_ni: 0.000313214
p_wrong: 9e-9
Data Source: BioPlex
ZNF644
Tbio
Family: TF
Novelty: 0.1231856
p_int: 0.999602211
p_ni: 0.000397789
Data Source: BioPlex
RBM14
Tbio
Novelty: 0.00695569
p_int: 0.99901856
p_ni: 0.000981276
p_wrong: 1.65e-7
Data Source: BioPlex
CELSR3
Tbio
Family: GPCR
Novelty: 0.03547783
p_int: 0.997587919
p_ni: 0.00241208
Data Source: BioPlex
ARHGAP22
Tbio
Family: Enzyme
Novelty: 0.20584913
p_int: 0.997364599
p_ni: 0.002530687
p_wrong: 0.000104713
Data Source: BioPlex
ZDBF2
Tdark
Novelty: 0.17094017
p_int: 0.996955833
p_ni: 0.003021254
p_wrong: 0.000022913
Data Source: BioPlex
Publication Statistics
PubMed Score  575.96

PubMed score by year
PubTator Score  207.11

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGV
1-70
WTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEE
70-140
CAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLS
140-210
ITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPR
210-280
VLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKA
280-350
KAVPS
350-355
MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS