You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
TTC9B
Tetratricopeptide repeat protein 9B

Protein Classes
IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 53   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 53   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (44)
1 – 10 of 44
PLCG1
Tchem
Family: Enzyme
Novelty: 0.00125418
p_int: 0.975590274
p_ni: 0.024371456
p_wrong: 0.000038269
Score: 0.187
Data Source: BioPlex,STRINGDB
CLTCL1
Tbio
Novelty: 0.05165674
p_int: 0.934983025
p_ni: 0.065016975
Score: 0.165
Data Source: BioPlex,STRINGDB
PPFIA1
Tbio
Novelty: 0.02180918
p_int: 0.929439571
p_ni: 0.070560303
p_wrong: 1.26e-7
Score: 0.245
Data Source: BioPlex,STRINGDB
HSPA4
Tbio
Novelty: 0.00010789
p_int: 0.755165318
p_ni: 0.244834682
Score: 0.332
Data Source: BioPlex,STRINGDB
HP1BP3
Tbio
Novelty: 0.08987802
Score: 0.668
Data Source: STRINGDB
DMAC2
Tbio
Family: Enzyme
Novelty: 2.4375
Score: 0.621
Data Source: STRINGDB
FBXL16
Tdark
Novelty: 1.26829268
Score: 0.6
Data Source: STRINGDB
HIPK4
Tchem
Family: Kinase
Novelty: 0.28985507
Score: 0.6
Data Source: STRINGDB
IRGQ
Tdark
Family: Enzyme
Score: 0.584
Data Source: STRINGDB
RTBDN
Tdark
Novelty: 0.23076923
Score: 0.584
Data Source: STRINGDB
Publication Statistics
PubMed Score  1.00

PubMed score by year
PubTator Score  1

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQRGALSPVLMLSAAPEPPPRPPPALSPPGSGPGSGSRHGSARPGPTPEPSGSLGAALDSSLRAAVAFKA
1-70
EGQRCYREKKFREAIGKYHRALLQLKAAQGARPSGLPAPAPGPTSSPGPARLSEEQRRLVESTEVECYDS
70-140
LTACLLQSELVNYERVREYCLKVLEKQQGNFKATYRAGIAFYHLGDYARALRYLQEARSREPTDTNVLRY
140-210
IQLTQLKMNRCSLQREDSGAGSQTRDVIG
210-239
MQRGALSPVLMLSAAPEPPPRPPPALSPPGSGPGSGSRHGSARPGPTPEPSGSLGAALDSSLRAAVAFKAEGQRCYREKKFREAIGKYHRALLQLKAAQGARPSGLPAPAPGPTSSPGPARLSEEQRRLVESTEVECYDSLTACLLQSELVNYERVREYCLKVLEKQQGNFKATYRAGIAFYHLGDYARALRYLQEARSREPTDTNVLRYIQLTQLKMNRCSLQREDSGAGSQTRDVIG