You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
AOPEP
Aminopeptidase O

Protein Summary
Description
Aminopeptidases catalyze the hydrolysis of amino acid residues from the N-terminus of peptide or protein substrates. Able to cleave angiotensin III to generate angiotensin IV, a bioactive peptide of the renin-angiotensin pathway. Not able to cleave angiotensin I and angiotensin II. May play a role in the proteolytic processing of bioactive peptides in tissues such as testis and heart. This gene encodes a member of the M1 zinc aminopeptidase family. The encoded protein is a zinc-dependent metallopeptidase that catalyzes the removal of an amino acid from the amino terminus of a protein or peptide. This protein may play a role in the generation of angiotensin IV. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000277198
  • ENSP00000277198
  • ENSG00000148120
  • ENST00000297979
  • ENSP00000297979
  • ENST00000375315
  • ENSP00000364464

Symbol
  • C9orf3
  • ONPEP
  • APO
  • AP-O
  • ONPEP
  • C90RF3
  • C9orf3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 58.43   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 83   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 58.43   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 83   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (3)
Metabolism of Angiotensinogen to Angiotensins (R-HSA-2022377)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of Angiotensinogen to Angiotensins
Reactome
Metabolism of proteins
Reactome
Peptide hormone metabolism
Name
Explore in Pharos
Explore in Source
Metabolism of Angiotensinogen to Angiotensins
Metabolism of proteins
Peptide hormone metabolism
Protein-Protein Interactions (36)
1 – 10 of 36
LRRC40
Tdark
Novelty: 7
p_int: 0.999928093
p_ni: 0.000071907
p_wrong: 1e-9
Score: 0.188
Data Source: BioPlex,STRINGDB
ZDHHC17
Tbio
Family: Enzyme
Novelty: 0.03352984
p_int: 0.989136232
p_ni: 0.010858975
p_wrong: 0.000004793
Score: 0.199
Data Source: BioPlex,STRINGDB
TUBA4A
Tchem
Novelty: 0.02626744
p_int: 0.891428458
p_ni: 0.108571542
Data Source: BioPlex
SUZ12
Tbio
Novelty: 0.00668683
p_int: 0.796513922
p_ni: 0.203171611
p_wrong: 0.000314467
Score: 0.189
Data Source: BioPlex,STRINGDB
TUBB3
Tclin
Novelty: 0.00281462
p_int: 0.767165823
p_ni: 0.232834177
Data Source: BioPlex
AGT
Tbio
Novelty: 0.00056146
Score: 0.903
Data Source: Reactome,STRINGDB
DENND1A
Tbio
Novelty: 0.06261011
Score: 0.674
Data Source: STRINGDB
SYNPO2L
Tdark
Novelty: 0.59240506
Score: 0.657
Data Source: STRINGDB
THADA
Tbio
Novelty: 0.02734274
Score: 0.571
Data Source: STRINGDB
TOX3
Tbio
Family: TF
Novelty: 0.02037559
Score: 0.56
Data Source: STRINGDB
Publication Statistics
PubMed Score  58.43

PubMed score by year
PubTator Score  105.17

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDIQLDPARDDLPLMANTSHILVKHYVLDLDVDFESQVIEGTIVLFLEDGNRFKKQNSSIEEACQSESNK
1-70
ACKFGMPEPCHIPVTNARTFSSEMEYNDFAICSKGEKDTSDKDGNHDNQEHASGISSSKYCCDTGNHGSE
70-140
DFLLVLDCCDLSVLKVEEVDVAAVPGLEKFTRSPELTVVSEEFRNQIVRELVTLPANRWREQLDYYARCS
140-210
QAPGCGELLFDTDTWSLQIRKTGAQTATDFPHAIRIWYKTKPEGRSVTWTSDQSGRPCVYTVGSPINNRA
210-280
LFPCQEPPVAMSTWQATVRAAASFVVLMSGENSAKPTQLWEECSSWYYYVTMPMPASTFTIAVGCWTEMK
280-350
METWSSNDLATERPFSPSEANFRHVGVCSHMEYPCRFQNASATTQEIIPHRVFAPVCLTGACQETLLRLI
350-420
PPCLSAAHSVLGAHPFSRLDVLIVPANFPSLGMASPHIMFLSQSILTGGNHLCGTRLCHEIAHAWFGLAI
420-490
GARDWTEEWLSEGFATHLEDVFWATAQQLAPYEAREQQELRACLRWRRLQDEMQCSPEEMQVLRPSKDKT
490-560
GHTSDSGASVIKHGLNPEKIFMQVHYLKGYFLLRFLAKRLGDETYFSFLRKFVHTFHGQLILSQDFLQML
560-630
LENIPEEKRLELSVENIYQDWLESSGIPKPLQRERRAGAECGLARQVRAEVTKWIGVNRRPRKRKRREKE
630-700
EVFEKLLPDQLVLLLEHLLEQKTLSPRTLQSLQRTYHLQDQDAEVRHRWCELIVKHKFTKAYKSVERFLQ
700-770
EDQAMGVYLYGELMVSEDARQQQLARRCFERTKEQMDRSSAQVVAEMLF
770-819
MDIQLDPARDDLPLMANTSHILVKHYVLDLDVDFESQVIEGTIVLFLEDGNRFKKQNSSIEEACQSESNKACKFGMPEPCHIPVTNARTFSSEMEYNDFAICSKGEKDTSDKDGNHDNQEHASGISSSKYCCDTGNHGSEDFLLVLDCCDLSVLKVEEVDVAAVPGLEKFTRSPELTVVSEEFRNQIVRELVTLPANRWREQLDYYARCSQAPGCGELLFDTDTWSLQIRKTGAQTATDFPHAIRIWYKTKPEGRSVTWTSDQSGRPCVYTVGSPINNRALFPCQEPPVAMSTWQATVRAAASFVVLMSGENSAKPTQLWEECSSWYYYVTMPMPASTFTIAVGCWTEMKMETWSSNDLATERPFSPSEANFRHVGVCSHMEYPCRFQNASATTQEIIPHRVFAPVCLTGACQETLLRLIPPCLSAAHSVLGAHPFSRLDVLIVPANFPSLGMASPHIMFLSQSILTGGNHLCGTRLCHEIAHAWFGLAIGARDWTEEWLSEGFATHLEDVFWATAQQLAPYEAREQQELRACLRWRRLQDEMQCSPEEMQVLRPSKDKTGHTSDSGASVIKHGLNPEKIFMQVHYLKGYFLLRFLAKRLGDETYFSFLRKFVHTFHGQLILSQDFLQMLLENIPEEKRLELSVENIYQDWLESSGIPKPLQRERRAGAECGLARQVRAEVTKWIGVNRRPRKRKRREKEEVFEKLLPDQLVLLLEHLLEQKTLSPRTLQSLQRTYHLQDQDAEVRHRWCELIVKHKFTKAYKSVERFLQEDQAMGVYLYGELMVSEDARQQQLARRCFERTKEQMDRSSAQVVAEMLF