You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
JAGN1
Protein jagunal homolog 1

Protein Summary
Description
Endoplasmic reticulum transmembrane protein involved in vesicle-mediated transport, which is required for neutrophil function. Required for vesicle-mediated transport; it is however unclear whether it is involved in early secretory pathway or intracellular protein transport. Acts as a regulator of neutrophil function, probably via its role in vesicle-mediated transport: required for defense against fungal pathogens and for granulocyte colony-stimulating factor (GM-CSF) signaling pathway; possibly by regulating glycosylation and/or targeting of proteins contributing to the viability and migration of neutrophils. The protein encoded by this gene is a transmembrane protein. It functions in the early secretory pathway and is necessary for neutrophil differentiation and survival. Mutations in this gene result in severe congenital neutropenia. [provided by RefSeq, Oct 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000307768
  • ENSP00000306106
  • ENSG00000171135
  • ENST00000647897
  • ENSP00000496942

Symbol
  • SCN6
  • GL009
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.96
kinase perturbation
0.91
transcription factor binding site profile
0.73
histone modification site profile
0.7
virus perturbation
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.57   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 58   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.57   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 58   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (30)
1 – 10 of 30
DDOST
Tchem
Family: Enzyme
Novelty: 0.02436696
Score: 0.873
Data Source: STRINGDB
SEC61A1
Tbio
Novelty: 0.00323898
Score: 0.866
Data Source: STRINGDB
TECR
Tbio
Family: Enzyme
Novelty: 0.00220663
Score: 0.852
Data Source: STRINGDB
CYP20A1
Tdark
Novelty: 0.15980124
Score: 0.611
Data Source: STRINGDB
G6PC3
Tbio
Family: Enzyme
Novelty: 0.02375748
Score: 0.585
Data Source: STRINGDB
SYNPR
Tbio
Novelty: 0.06151316
Score: 0.578
Data Source: STRINGDB
WDR46
Tdark
Novelty: 0.36421448
Score: 0.56
Data Source: STRINGDB
RNF8
Tbio
Family: Enzyme
Novelty: 0.01431788
Score: 0.559
Data Source: STRINGDB
SPC25
Tbio
Novelty: 0.48
Score: 0.553
Data Source: STRINGDB
ATP2B4
Tbio
Family: Transporter
Novelty: 0.00694066
Score: 0.534
Data Source: STRINGDB
Publication Statistics
PubMed Score  5.57

PubMed score by year
PubTator Score  8.1

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASRAGPRAAGTDGSDFQHRERVAMHYQMSVTLKYEIKKLIYVHLVIWLLLVAKMSVGHLRLLSHDQVAM
1-70
PYQWEYPYLLSILPSLLGLLSFPRNNISYLVLSMISMGLFSIAPLIYGSMEMFPAAQQLYRHGKAYRFLF
70-140
GFSAVSIMYLVLVLAVQVHAWQLYYSKKLLDSWFTSTQEKKHK
140-183
MASRAGPRAAGTDGSDFQHRERVAMHYQMSVTLKYEIKKLIYVHLVIWLLLVAKMSVGHLRLLSHDQVAMPYQWEYPYLLSILPSLLGLLSFPRNNISYLVLSMISMGLFSIAPLIYGSMEMFPAAQQLYRHGKAYRFLFGFSAVSIMYLVLVLAVQVHAWQLYYSKKLLDSWFTSTQEKKHK