You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ATPAF2
ATP synthase mitochondrial F1 complex assembly factor 2

Protein Summary
Description
May play a role in the assembly of the F1 component of the mitochondrial ATP synthase (ATPase). This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 alpha subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. This gene is located within the Smith-Magenis syndrome region on chromosome 17. An alternatively spliced transcript variant has been described, but its biological validity has not been determined. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000474627
  • ENSP00000417190
  • ENSG00000171953

Symbol
  • ATP12
  • ATP12
  • ATP12p
  • LP3663
  • MC5DN1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.91
histone modification site profile
0.82
transcription factor binding site profile
0.79
transcription factor
0.68
tissue
0.59


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 13.61   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 119   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 13.61   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 119   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (4)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
HPA
Inferred from Direct Assay (IDA)
LIFEdb
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Protein-Protein Interactions (124)
1 – 10 of 124
SPG21
Tbio
Family: Enzyme
Novelty: 0.08660933
p_int: 0.999999936
p_ni: 6.1e-8
p_wrong: 3e-9
Score: 0.319
Data Source: BioPlex,STRINGDB
FMC1
Tbio
Novelty: 0.05942695
p_int: 0.999999801
p_ni: 1.99e-7
Score: 0.96
Data Source: BioPlex,STRINGDB
FECH
Tbio
Family: Enzyme
Novelty: 0.00199177
p_int: 0.999995567
p_ni: 0.000004433
Score: 0.203
Data Source: BioPlex,STRINGDB
NDUFAB1
Tclin
Novelty: 0.00207106
p_int: 0.999975874
p_ni: 0.000024126
Score: 0.447
Data Source: BioPlex,STRINGDB
OXLD1
Tdark
Family: Enzyme
p_int: 0.999630229
p_ni: 0.000369769
p_wrong: 2e-9
Score: 0.228
Data Source: BioPlex,STRINGDB
KLHL22
Tbio
Novelty: 0.50704225
p_int: 0.998138814
p_ni: 0.001861186
Data Source: BioPlex
MRM1
Tbio
Family: Enzyme
Novelty: 0.27243243
p_int: 0.997541541
p_ni: 0.001995765
p_wrong: 0.000462694
Score: 0.402
Data Source: BioPlex,STRINGDB
HINT2
Tbio
Novelty: 0.0404157
p_int: 0.997325948
p_ni: 0.002230059
p_wrong: 0.000443993
Data Source: BioPlex
FAM124A
Tdark
Novelty: 3.33333333
p_int: 0.997138663
p_ni: 0.002386277
p_wrong: 0.00047506
Data Source: BioPlex
ECHS1
Tbio
Family: Enzyme
Novelty: 0.01956365
p_int: 0.992336533
p_ni: 0.007448851
p_wrong: 0.000214616
Score: 0.478
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  13.61

PubMed score by year
PubTator Score  6.26

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MWRSCLRLRDGGRRLLNRPAGGPSASMSPGPTIPSPARAYAPPTERKRFYQNVSITQGEGGFEINLDHRK
1-70
LKTPQAKLFTVPSEALAIAVATEWDSQQDTIKYYTMHLTTLCNTSLDNPTQRNKDQLIRAAVKFLDTDTI
70-140
CYRVEEPETLVELQRNEWDPIIEWAEKRYGVEISSSTSIMGPSIPAKTREVLVSHLASYNTWALQGIEFV
140-210
AAQLKSMVLTLGLIDLRLTVEQAVLLSRLEEEYQIQKWGNIEWAHDYELQELRARTAAGTLFIHLCSEST
210-280
TVKHKLLKE
280-289
MWRSCLRLRDGGRRLLNRPAGGPSASMSPGPTIPSPARAYAPPTERKRFYQNVSITQGEGGFEINLDHRKLKTPQAKLFTVPSEALAIAVATEWDSQQDTIKYYTMHLTTLCNTSLDNPTQRNKDQLIRAAVKFLDTDTICYRVEEPETLVELQRNEWDPIIEWAEKRYGVEISSSTSIMGPSIPAKTREVLVSHLASYNTWALQGIEFVAAQLKSMVLTLGLIDLRLTVEQAVLLSRLEEEYQIQKWGNIEWAHDYELQELRARTAAGTLFIHLCSESTTVKHKLLKE