You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TAB3
TGF-beta-activated kinase 1 and MAP3K7-binding protein 3

Protein Summary
Description
Adapter linking MAP3K7/TAK1 and TRAF6 or TRAF2. Mediator of MAP3K7 activation, respectively in the IL1 and TNF signaling pathways. Plays a role in activation of NF-kappa-B and AP1 transcription factor. Isoform 2 may be an oncogenic factor. The product of this gene functions in the NF-kappaB signal transduction pathway. The encoded protein, and the similar and functionally redundant protein MAP3K7IP2/TAB2, forms a ternary complex with the protein kinase MAP3K7/TAK1 and either TRAF2 or TRAF6 in response to stimulation with the pro-inflammatory cytokines TNF or IL-1. Subsequent MAP3K7/TAK1 kinase activity triggers a signaling cascade leading to activation of the NF-kappaB transcription factor. The human genome contains a related pseudogene. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000378930
  • ENSP00000368212
  • ENSG00000157625
  • ENST00000378932
  • ENSP00000368214
  • ENST00000378933
  • ENSP00000368215

Symbol
  • MAP3K7IP3
  • NAP1
  • MAP3K7IP3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.85
histone modification site profile
0.76
pathway
0.76
cellular component
0.63
tissue sample
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 31.78   (req: < 5)
Gene RIFs: 19   (req: <= 3)
Antibodies: 258   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 31.78   (req: >= 5)
Gene RIFs: 19   (req: > 3)
Antibodies: 258   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (52)
C-type lectin receptors (CLRs) (R-HSA-5621481)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 41
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
C-type lectin receptors (CLRs)
Reactome
CLEC7A (Dectin-1) signaling
Reactome
Cytokine Signaling in Immune system
Reactome
Death Receptor Signalling
Reactome
FCERI mediated NF-kB activation
Name
Explore in Pharos
Explore in Source
C-type lectin receptors (CLRs)
CLEC7A (Dectin-1) signaling
Cytokine Signaling in Immune system
Death Receptor Signalling
FCERI mediated NF-kB activation
Gene Ontology Terms (15)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (109)
1 – 10 of 109
TAB1
Tchem
Family: Kinase
Novelty: 0.01006931
p_int: 0.999999997
p_ni: 3e-9
Score: 0.996
Data Source: BioPlex,Reactome,STRINGDB
EMILIN1
Tbio
Novelty: 0.0305471
p_int: 0.999999929
p_ni: 3.2e-8
p_wrong: 3.9e-8
Score: 0.197
Data Source: BioPlex,STRINGDB
UBC
Tbio
Novelty: 0.00161137
Score: 0.997
Data Source: STRINGDB
MAP3K7
Tchem
Family: Kinase
Novelty: 0.00697684
Score: 0.995
Data Source: Reactome,STRINGDB
UBB
Tbio
Novelty: 0.00895161
Score: 0.995
Data Source: STRINGDB
UBA52
Tbio
Novelty: 0.01006012
Score: 0.995
Data Source: STRINGDB
IKBKG
Tbio
Family: Kinase
Novelty: 0.00081998
Score: 0.991
Data Source: Reactome,STRINGDB
TAB2
Tbio
Family: Enzyme
Novelty: 0.01174781
Score: 0.988
Data Source: Reactome,STRINGDB
RPS27A
Tbio
Novelty: 0.01148413
Score: 0.984
Data Source: STRINGDB
TRAF6
Tbio
Novelty: 0.00159491
Score: 0.98
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  31.78

PubMed score by year
PubTator Score  14.56

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAQSSPQLDIQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQESSKYLYMEYHSPDDNRMNRNR
1-70
LLHINLGIHSPSSYHPGDGAQLNGGRTLVHSSSDGHIDPQHAAGKQLICLVQEPHSAPAVVAATPNYNPF
70-140
FMNEQNRSAATPPSQPPQQPSSMQTGMNPSAMQGPSPPPPPPSYMHIPRYSTNPITVTVSQNLPSGQTVP
140-210
RALQILPQIPSNLYGSPGSIYIRQTSQSSSGRQTPQSTPWQSSPQGPVPHYSQRPLPVYPHQQNYQPSQY
210-280
SPKQQQIPQSAYHSPPPSQCPSPFSSPQHQVQPSQLGHIFMPPSPSTTPPHPYQQGPPSYQKQGSHSVAY
280-350
LPYTASSLSKGSMKKIEITVEPSQRPGTAINRSPSPISNQPSPRNQHSLYTATTPPSSSPSRGISSQPKP
350-420
PFSVNPVYITYTQPTGPSCTPSPSPRVIPNPTTVFKITVGRATTENLLNLVDQEERSAAPEPIQPISVIP
420-490
GSGGEKGSHKYQRSSSSGSDDYAYTQALLLHQRARMERLAKQLKLEKEELERLKSEVNGMEHDLMQRRLR
490-560
RVSCTTAIPTPEEMTRLRSMNRQLQINVDCTLKEVDLLQSRGNFDPKAMNNFYDNIEPGPVVPPKPSKKD
560-630
SSDPCTIERKARRISVTSKVQADIHDTQAAAADEHRTGSTQSPRTQPRDEDYEGAPWNCDSCTFLNHPAL
630-700
NRCEQCEMPRYT
700-712
MAQSSPQLDIQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQESSKYLYMEYHSPDDNRMNRNRLLHINLGIHSPSSYHPGDGAQLNGGRTLVHSSSDGHIDPQHAAGKQLICLVQEPHSAPAVVAATPNYNPFFMNEQNRSAATPPSQPPQQPSSMQTGMNPSAMQGPSPPPPPPSYMHIPRYSTNPITVTVSQNLPSGQTVPRALQILPQIPSNLYGSPGSIYIRQTSQSSSGRQTPQSTPWQSSPQGPVPHYSQRPLPVYPHQQNYQPSQYSPKQQQIPQSAYHSPPPSQCPSPFSSPQHQVQPSQLGHIFMPPSPSTTPPHPYQQGPPSYQKQGSHSVAYLPYTASSLSKGSMKKIEITVEPSQRPGTAINRSPSPISNQPSPRNQHSLYTATTPPSSSPSRGISSQPKPPFSVNPVYITYTQPTGPSCTPSPSPRVIPNPTTVFKITVGRATTENLLNLVDQEERSAAPEPIQPISVIPGSGGEKGSHKYQRSSSSGSDDYAYTQALLLHQRARMERLAKQLKLEKEELERLKSEVNGMEHDLMQRRLRRVSCTTAIPTPEEMTRLRSMNRQLQINVDCTLKEVDLLQSRGNFDPKAMNNFYDNIEPGPVVPPKPSKKDSSDPCTIERKARRISVTSKVQADIHDTQAAAADEHRTGSTQSPRTQPRDEDYEGAPWNCDSCTFLNHPALNRCEQCEMPRYT