You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TTC30B
Tetratricopeptide repeat protein 30B

Protein Summary
Description
Required for polyglutamylation of axonemal tubulin. Plays a role in anterograde intraflagellar transport (IFT), the process by which cilia precursors are transported from the base of the cilium to the site of their incorporation at the tip.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000408939
  • ENSP00000386181
  • ENSG00000196659

Symbol
  • IFT70
  • fleer
  • IFT70B
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.89
gene perturbation
0.73
tissue sample
0.63
virus perturbation
0.59
protein domain
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.3   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 91   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.3   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 91   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Cilium Assembly (R-HSA-5617833)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cilium Assembly
Reactome
Intraflagellar transport
Reactome
Organelle biogenesis and maintenance
Name
Explore in Pharos
Explore in Source
Cilium Assembly
Intraflagellar transport
Organelle biogenesis and maintenance
Gene Ontology Terms (5)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
Reactome
Protein-Protein Interactions (64)
1 – 10 of 64
IFT57
Tbio
Novelty: 0.04669088
p_int: 0.999999997
p_ni: 3e-9
Score: 0.995
Data Source: BioPlex,STRINGDB
IFT52
Tbio
Novelty: 0.06710552
p_int: 0.999999812
p_ni: 1.88e-7
Score: 0.998
Data Source: BioPlex,STRINGDB
CLUAP1
Tbio
Novelty: 0.04309387
p_int: 0.999999802
p_ni: 1.97e-7
Score: 0.992
Data Source: BioPlex,STRINGDB
IFT46
Tdark
Novelty: 0.12885412
p_int: 0.999999733
p_ni: 2.65e-7
p_wrong: 2e-9
Score: 0.997
Data Source: BioPlex,STRINGDB
IFT81
Tbio
Novelty: 0.00856499
p_int: 0.999999682
p_ni: 3.18e-7
Score: 0.993
Data Source: BioPlex,STRINGDB
IFT88
Tbio
Novelty: 0.00935043
p_int: 0.99999939
p_ni: 7.5e-8
p_wrong: 5.35e-7
Score: 0.992
Data Source: BioPlex,STRINGDB
IFT27
Tbio
Family: Enzyme
Novelty: 0.04978515
p_int: 0.999999037
p_ni: 9.63e-7
Score: 0.981
Data Source: BioPlex,STRINGDB
IFT80
Tbio
Novelty: 0.07705762
p_int: 0.999998391
p_ni: 6.6e-7
p_wrong: 9.49e-7
Score: 0.99
Data Source: BioPlex,STRINGDB
IFT22
Tdark
Family: Enzyme
Novelty: 0.48997773
p_int: 0.99999719
p_ni: 0.00000281
Score: 0.994
Data Source: BioPlex,STRINGDB
IFT74
Tbio
Novelty: 0.11938601
p_int: 0.999996787
p_ni: 0.000003213
Score: 0.996
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  6.30

PubMed score by year
PubTator Score  11.42

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAGLSGAQIPDGEFTAVVYRLIRNARYAEAVQLLGGELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQ
1-70
LGQLHPELEQYRLYQAQALYKACLYAEATRVAFLLLDNPAYHSRVLRLQAAIKYSEGDLPGSRSLVEQLP
70-140
SREGGEESGGENETDGQINLGCLLYKEGQYEAACSKFFAALQASGYQPDLSYNLALAYYSSRQYASALKH
140-210
IAEIIERGIRQHPELGVGMTTEGIDVRSVGNTLVLHQTALVEAFNLKAAIEYQLRNYEAAQEALTDMPPR
210-280
AEEELDPVTLHNQALMNMDARPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLI
280-350
YKFLTPYLYDFLDAVITCQTAPEEAFIKLDGLAGMLTEVLRKLTIQVQEARHNRDDEAIKKAVNEYDETM
350-420
EKYIPVLMAQAKIYWNLENYPMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKHY
420-490
DNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDPDKKMYHLCIVNLVIGTLYCAKGNY
490-560
DFGISRVIKSLEPYNKKLGTDTWYYAKRCFLSLLENMSKHTIMLRDSVIQECVQFLEHCELHGRNIPAVI
560-630
EQPLEEERMHVGKNTVTYESRQLKALIYEIIGWNI
630-665
MAGLSGAQIPDGEFTAVVYRLIRNARYAEAVQLLGGELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQLGQLHPELEQYRLYQAQALYKACLYAEATRVAFLLLDNPAYHSRVLRLQAAIKYSEGDLPGSRSLVEQLPSREGGEESGGENETDGQINLGCLLYKEGQYEAACSKFFAALQASGYQPDLSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVGMTTEGIDVRSVGNTLVLHQTALVEAFNLKAAIEYQLRNYEAAQEALTDMPPRAEEELDPVTLHNQALMNMDARPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLIYKFLTPYLYDFLDAVITCQTAPEEAFIKLDGLAGMLTEVLRKLTIQVQEARHNRDDEAIKKAVNEYDETMEKYIPVLMAQAKIYWNLENYPMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDPDKKMYHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYNKKLGTDTWYYAKRCFLSLLENMSKHTIMLRDSVIQECVQFLEHCELHGRNIPAVIEQPLEEERMHVGKNTVTYESRQLKALIYEIIGWNI