You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GALNT15
Polypeptide N-acetylgalactosaminyltransferase 15

Protein Summary
Description
Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Although it displays a much weaker activity toward all substrates tested compared to GALNT2, it is able to transfer up to seven GalNAc residues to the Muc5AC peptide, suggesting that it can fill vicinal Thr/Ser residues in cooperation with other GALNT proteins. Prefers Muc1a as substrate.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000339732
  • ENSP00000344260
  • ENSG00000131386

Symbol
  • GALNTL2
  • PIH5
  • GALNT7
  • GALNT13
  • GALNTL2
  • GALNACT15
  • pp-GalNAc-T15
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
microRNA
0.68
cellular component
0.6
tissue
0.56
kinase perturbation
0.54
metabolite
0.45


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.28   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 61   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.28   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 61   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Metabolism of proteins (R-HSA-392499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of proteins
Reactome
O-linked glycosylation
Reactome
O-linked glycosylation of mucins
Reactome
Post-translational protein modification
Name
Explore in Pharos
Explore in Source
Metabolism of proteins
O-linked glycosylation
O-linked glycosylation of mucins
Post-translational protein modification
Protein-Protein Interactions (46)
1 – 10 of 46
MUC1
Tbio
Novelty: 0.00029046
Score: 0.966
Data Source: STRINGDB
C1GALT1
Tbio
Family: Enzyme
Novelty: 0.01514342
Score: 0.954
Data Source: STRINGDB
MUC5AC
Tbio
Novelty: 0.00053768
Score: 0.929
Data Source: STRINGDB
MUC13
Tbio
Novelty: 0.01261341
Score: 0.92
Data Source: STRINGDB
MUC6
Tbio
Novelty: 0.00438241
Score: 0.919
Data Source: STRINGDB
MUC12
Tbio
Novelty: 0.07903718
Score: 0.918
Data Source: STRINGDB
MUC20
Tbio
Novelty: 0.07155729
Score: 0.913
Data Source: STRINGDB
MUC7
Tbio
Novelty: 0.00971879
Score: 0.913
Data Source: STRINGDB
MUC4
Tbio
Novelty: 0.00238494
Score: 0.912
Data Source: STRINGDB
MUC16
Tbio
Novelty: 0.00651162
Score: 0.912
Data Source: STRINGDB
Publication Statistics
PubMed Score  12.28

PubMed score by year
PubTator Score  5.03

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLLRKRYRHRPCRLQFLLLLLMLGCVLMMVAMLHPPHHTLHQTVTAQASKHSPEARYRLDFGESQDWVLE
1-70
AEDEGEEYSPLEGLPPFISLREDQLLVAVALPQARRNQSQGRRGGSYRLIKQPRRQDKEAPKRDWGADED
70-140
GEVSEEEELTPFSLDPRGLQEALSARIPLQRALPEVRHPLCLQQHPQDSLPTASVILCFHDEAWSTLLRT
140-210
VHSILDTVPRAFLKEIILVDDLSQQGQLKSALSEYVARLEGVKLLRSNKRLGAIRARMLGATRATGDVLV
210-280
FMDAHCECHPGWLEPLLSRIAGDRSRVVSPVIDVIDWKTFQYYPSKDLQRGVLDWKLDFHWEPLPEHVRK
280-350
ALQSPISPIRSPVVPGEVVAMDRHYFQNTGAYDSLMSLRGGENLELSFKAWLCGGSVEILPCSRVGHIYQ
350-420
NQDSHSPLDQEATLRNRVRIAETWLGSFKETFYKHSPEAFSLSKAEKPDCMERLQLQRRLGCRTFHWFLA
420-490
NVYPELYPSEPRPSFSGKLHNTGLGLCADCQAEGDILGCPMVLAPCSDSRQQQYLQHTSRKEIHFGSPQH
490-560
LCFAVRQEQVILQNCTEEGLAIHQQHWDFQENGMIVHILSGKCMEAVVQENNKDLYLRPCDGKARQQWRF
560-630
DQINAVDER
630-639
MLLRKRYRHRPCRLQFLLLLLMLGCVLMMVAMLHPPHHTLHQTVTAQASKHSPEARYRLDFGESQDWVLEAEDEGEEYSPLEGLPPFISLREDQLLVAVALPQARRNQSQGRRGGSYRLIKQPRRQDKEAPKRDWGADEDGEVSEEEELTPFSLDPRGLQEALSARIPLQRALPEVRHPLCLQQHPQDSLPTASVILCFHDEAWSTLLRTVHSILDTVPRAFLKEIILVDDLSQQGQLKSALSEYVARLEGVKLLRSNKRLGAIRARMLGATRATGDVLVFMDAHCECHPGWLEPLLSRIAGDRSRVVSPVIDVIDWKTFQYYPSKDLQRGVLDWKLDFHWEPLPEHVRKALQSPISPIRSPVVPGEVVAMDRHYFQNTGAYDSLMSLRGGENLELSFKAWLCGGSVEILPCSRVGHIYQNQDSHSPLDQEATLRNRVRIAETWLGSFKETFYKHSPEAFSLSKAEKPDCMERLQLQRRLGCRTFHWFLANVYPELYPSEPRPSFSGKLHNTGLGLCADCQAEGDILGCPMVLAPCSDSRQQQYLQHTSRKEIHFGSPQHLCFAVRQEQVILQNCTEEGLAIHQQHWDFQENGMIVHILSGKCMEAVVQENNKDLYLRPCDGKARQQWRFDQINAVDER