You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
STK40
Serine/threonine-protein kinase 40

Protein Summary
Description
May be a negative regulator of NF-kappa-B and p53-mediated gene transcription.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000359297
  • ENSP00000352245
  • ENSG00000196182
  • ENST00000373129
  • ENSP00000362221
  • ENST00000373130
  • ENSP00000362222
  • ENST00000373132
  • ENSP00000362224

Symbol
  • SGK495
  • SHIK
  • SHIK
  • SgK495
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor binding site profile
0.97
molecular function
0.91
disease perturbation
0.83
transcription factor
0.82
microRNA
0.81


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.8   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 150   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.8   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 150   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (12)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (47)
1 – 10 of 47
TRIB1
Tbio
Family: Kinase
Novelty: 0.01783401
p_int: 1
Score: 0.886
Data Source: BioPlex,STRINGDB
TRIB2
Tbio
Family: Kinase
Novelty: 0.02702835
p_int: 0.999999812
p_ni: 1.87e-7
Score: 0.721
Data Source: BioPlex,STRINGDB
COP1
Tbio
Family: Enzyme
Novelty: 0.28704864
p_int: 0.999999429
p_ni: 5.71e-7
Score: 0.944
Data Source: BioPlex,STRINGDB
WASHC1
Tbio
Novelty: 0.1892021
p_int: 0.999997046
p_ni: 0.000002952
p_wrong: 2e-9
Data Source: BioPlex
ETV5
Tbio
Family: TF
Novelty: 0.00082134
p_int: 0.999992285
p_ni: 0.000007712
p_wrong: 4e-9
Score: 0.823
Data Source: BioPlex,STRINGDB
FOS
Tbio
Family: TF
Novelty: 0.00007002
p_int: 0.999988466
p_ni: 0.000011534
Score: 0.827
Data Source: BioPlex,STRINGDB
ETV1
Tbio
Family: TF
Novelty: 0.00700634
p_int: 0.999901063
p_ni: 0.000098937
Score: 0.859
Data Source: BioPlex,STRINGDB
DET1
Tbio
Novelty: 0.01807423
p_int: 0.999774762
p_ni: 0.000225236
p_wrong: 2e-9
Score: 0.817
Data Source: BioPlex,STRINGDB
JUNB
Tbio
Family: TF
Novelty: 0.01119828
p_int: 0.998516561
p_ni: 0.001483111
p_wrong: 3.29e-7
Score: 0.75
Data Source: BioPlex,STRINGDB
FOSL2
Tbio
Family: TF
Novelty: 0.006377
p_int: 0.998087537
p_ni: 0.001912296
p_wrong: 1.67e-7
Score: 0.627
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  10.80

PubMed score by year
PubTator Score  9.57

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MKRRASDRGAGETSARAKALGSGISGNNAKRAGPFILGPRLGNSPVPSIVQCLARKDGTDDFYQLKILTL
1-70
EERGDQGIESQEERQGKMLLHTEYSLLSLLHTQDGVVHHHGLFQDRTCEIVEDTESSRMVKKMKKRICLV
70-140
LDCLCAHDFSDKTADLINLQHYVIKEKRLSERETVVIFYDVVRVVEALHQKNIVHRDLKLGNMVLNKRTH
140-210
RITITNFCLGKHLVSEGDLLKDQRGSPAYISPDVLSGRPYRGKPSDMWALGVVLFTMLYGQFPFYDSIPQ
210-280
ELFRKIKAAEYTIPEDGRVSENTVCLIRKLLVLDPQQRLAAADVLEALSAIIASWQSLSSLSGPLQVVPD
280-350
IDDQMSNADSSQEAKVTEECSQYEFENYMRQQLLLAEEKSSIHDARSWVPKRQFGSAPPVRRLGHDAQPM
350-420
TSLDTAILAQRYLRK
420-435
MKRRASDRGAGETSARAKALGSGISGNNAKRAGPFILGPRLGNSPVPSIVQCLARKDGTDDFYQLKILTLEERGDQGIESQEERQGKMLLHTEYSLLSLLHTQDGVVHHHGLFQDRTCEIVEDTESSRMVKKMKKRICLVLDCLCAHDFSDKTADLINLQHYVIKEKRLSERETVVIFYDVVRVVEALHQKNIVHRDLKLGNMVLNKRTHRITITNFCLGKHLVSEGDLLKDQRGSPAYISPDVLSGRPYRGKPSDMWALGVVLFTMLYGQFPFYDSIPQELFRKIKAAEYTIPEDGRVSENTVCLIRKLLVLDPQQRLAAADVLEALSAIIASWQSLSSLSGPLQVVPDIDDQMSNADSSQEAKVTEECSQYEFENYMRQQLLLAEEKSSIHDARSWVPKRQFGSAPPVRRLGHDAQPMTSLDTAILAQRYLRK