You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
THEM5
Acyl-coenzyme A thioesterase THEM5

Protein Summary
Description
Has acyl-CoA thioesterase activity towards long-chain (C16 and C18) fatty acyl-CoA substrates, with a preference for linoleoyl-CoA and other unsaturated long-chain fatty acid-CoA esters. Plays an important role in mitochondrial fatty acid metabolism, and in remodeling of the mitochondrial lipid cardiolipin. Required for normal mitochondrial function.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000368817
  • ENSP00000357807
  • ENSG00000196407

Symbol
  • ACOT15
  • ACOT15
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.75
tissue sample
0.52
gene perturbation
0.5
cell type or tissue
0.46
disease
0.45


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 127.95   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 64   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 127.95   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 64   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (5)
Fatty acid metabolism (R-HSA-8978868)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Fatty acid metabolism
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Mitochondrial Fatty Acid Beta-Oxidation
Name
Explore in Pharos
Explore in Source
Fatty acid metabolism
Metabolism
Metabolism of lipids
Mitochondrial Fatty Acid Beta-Oxidation
Protein-Protein Interactions (26)
1 – 10 of 26
THEM4
Tbio
Family: Enzyme
Novelty: 0.00511448
p_int: 0.99999994
p_ni: 6e-8
Data Source: BioPlex
GPT2
Tbio
Family: Enzyme
Novelty: 0.00544179
p_int: 0.999999418
p_ni: 5.82e-7
Data Source: BioPlex
NBR1
Tbio
Novelty: 0.0159538
p_int: 0.99895318
p_ni: 0.001032673
p_wrong: 0.000014146
Data Source: BioPlex
KLHL15
Tbio
Novelty: 0.68181818
p_int: 0.916434033
p_ni: 0.083565967
Data Source: BioPlex
HARS2
Tbio
Family: Enzyme
Novelty: 0.00324876
p_int: 0.873466225
p_ni: 0.104258838
p_wrong: 0.022274937
Data Source: BioPlex
NME6
Tbio
Family: Kinase
Novelty: 0.1631596
p_int: 0.801587094
p_ni: 0.198407353
p_wrong: 0.000005553
Score: 0.299
Data Source: BioPlex,STRINGDB
FAM83F
Tbio
Novelty: 0.18927445
Score: 0.675
Data Source: STRINGDB
CERS3
Tbio
Family: TF
Novelty: 0.06580864
Score: 0.634
Data Source: STRINGDB
PNPLA1
Tbio
Family: Enzyme
Novelty: 0.03557262
Score: 0.632
Data Source: STRINGDB
ACOT13
Tbio
Family: Enzyme
Novelty: 0.00562524
Score: 0.579
Data Source: STRINGDB
Publication Statistics
PubMed Score  127.95

PubMed score by year
PubTator Score  3.83

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MIRRCFQVAARLGHHRGLLEAPRILPRLNPASAFGSSTDSMFSRFLPEKTDLKDYALPNASWCSDMLSLY
1-70
QEFLEKTKSSGWIKLPSFKSNRDHIRGLKLPSGLAVSSDKGDCRIFTRCIQVEGQGFEYVIFFQPTQKKS
70-140
VCLFQPGSYLEGPPGFAHGGSLAAMMDETFSKTAFLAGEGLFTLSLNIRFKNLIPVDSLVVMDVELDKIE
140-210
DQKLYMSCIAHSRDQQTVYAKSSGVFLQLQLEEESPQ
210-247
MIRRCFQVAARLGHHRGLLEAPRILPRLNPASAFGSSTDSMFSRFLPEKTDLKDYALPNASWCSDMLSLYQEFLEKTKSSGWIKLPSFKSNRDHIRGLKLPSGLAVSSDKGDCRIFTRCIQVEGQGFEYVIFFQPTQKKSVCLFQPGSYLEGPPGFAHGGSLAAMMDETFSKTAFLAGEGLFTLSLNIRFKNLIPVDSLVVMDVELDKIEDQKLYMSCIAHSRDQQTVYAKSSGVFLQLQLEEESPQ