You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LILRA2
Leukocyte immunoglobulin-like receptor subfamily A member 2

Protein Classes
Protein Summary
Description
Part of the innate immune responses against microbial infection (PubMed:12529506, PubMed:27572839). Specifically recognizes a set of N-terminally truncated immunoglobulins that are produced via cleavage by proteases from a range of pathogenic bacteria and fungi, including L.pneumophila, M.hyorhinis, S.pneumoniae, S.aureus and C.albicans (PubMed:27572839). Recognizes epitopes that are in part in the variable region of the immunoglobulin light chains, but requires also the constant region for signaling (PubMed:27572839). Binds to a subset of cleaved IgM, IgG3 and IgG4 molecules, but does not bind cleaved IgA1 (PubMed:27572839). Binding of N-terminally truncated immunoglobulins mediates activation of neutrophils (PubMed:27572839). In monocytes, activation leads to the release of CSF2, CF3, IL6, CXCL8 and CCL3 and down-regulates responses to bacterial lipopolysaccharide (LPS), possibly via down-regulation of TLR4 expression and reduced signaling via TLR4 (PubMed:22479404). In eosinophils, ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000251376
  • ENSP00000251376
  • ENSG00000239998
  • ENST00000251377
  • ENSP00000251377
  • ENST00000391738
  • ENSP00000375618
  • ENST00000611940
  • ENSP00000478981
  • ENSG00000275290
  • ENST00000613573
  • ENSP00000479743
  • ENST00000616629
  • ENSP00000481338
  • ENST00000617409
  • ENSP00000479914
  • ENSG00000274000
  • ENST00000620279
  • ENSP00000480939
  • ENST00000621721
  • ENSP00000484762
  • ENSG00000278634
  • ENST00000622640
  • ENSP00000483906

Symbol
  • ILT1
  • LIR7
  • ILT1
  • LIR7
  • CD85H
  • LIR-7
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue sample
0.67
kinase perturbation
0.66
cell type or tissue
0.58
protein domain
0.58
tissue
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.91   (req: < 5)
Gene RIFs: 10   (req: <= 3)
Antibodies: 308   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.91   (req: >= 5)
Gene RIFs: 10   (req: > 3)
Antibodies: 308   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 19
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (5)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Immune System
Reactome
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Immune System
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Gene Ontology Terms (21)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (95)
1 – 10 of 95
HLA-G
Tbio
Novelty: 0.00082058
Score: 0.938
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.925
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.925
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.925
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.925
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.925
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.925
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.925
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.925
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.925
Data Source: STRINGDB
Publication Statistics
PubMed Score  10.91

PubMed score by year
PubTator Score  12.9

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWV
1-70
RRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVT
70-140
LQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPS
140-210
DLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANF
210-280
TLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQF
280-350
HTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSEA
350-420
AETLSPSQNKTDSTTTSLGQHPQDYTVENLIRMGVAGLVLVVLGILLFEAQHSQRSLQDAAGR
420-483
MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSEAAETLSPSQNKTDSTTTSLGQHPQDYTVENLIRMGVAGLVLVVLGILLFEAQHSQRSLQDAAGR