You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
FAM177A1
Protein FAM177A1

Protein Summary
Description
This gene encodes a member of a conserved protein family. Alternative splicing results in multiple transcript variants. This gene is thought to be associated with susceptibility to juvenile idiopathic arthritis. [provided by RefSeq, Apr 2017]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000280987
  • ENSP00000280987
  • ENSG00000151327
  • ENST00000382406
  • ENSP00000371843
  • ENST00000396472
  • ENSP00000379734

Symbol
  • C14orf24
  • C14orf24
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cellular component
0.84
microRNA
0.62
tissue sample
0.62
cell line
0.53
tissue
0.46


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.72   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 39   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.72   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 39   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (40)
1 – 10 of 40
CLCN7
Tchem
Family: IC
Novelty: 0.00978278
p_int: 0.999848897
p_ni: 0.000151103
Data Source: BioPlex
MRPS31
Tdark
Novelty: 0.60504202
p_int: 0.999020158
p_ni: 0.000977978
p_wrong: 0.000001865
Data Source: BioPlex
RHOJ
Tbio
Family: Enzyme
Novelty: 0.00197189
p_int: 0.99719946
p_ni: 0.002800539
Score: 0.179
Data Source: BioPlex,STRINGDB
FAM204A
Tdark
p_int: 0.996654703
p_ni: 0.003282926
p_wrong: 0.000062372
Score: 0.217
Data Source: BioPlex,STRINGDB
SLC27A2
Tbio
Family: Transporter
Novelty: 0.01635728
p_int: 0.991186157
p_ni: 0.008813843
Data Source: BioPlex
VPS13B
Tbio
Novelty: 0.01384539
p_int: 0.987149993
p_ni: 0.012850007
Score: 0.202
Data Source: BioPlex,STRINGDB
OSTM1
Tbio
Novelty: 0.04716423
p_int: 0.981973289
p_ni: 0.000106335
p_wrong: 0.017920376
Score: 0.165
Data Source: BioPlex,STRINGDB
GTF2F2
Tbio
Novelty: 0.02786576
p_int: 0.977116422
p_ni: 0.000254204
p_wrong: 0.022629374
Score: 0.277
Data Source: BioPlex,STRINGDB
FAM207A
Tdark
Novelty: 0.69767442
p_int: 0.955558657
p_ni: 0.044441343
Score: 0.179
Data Source: BioPlex,STRINGDB
TGS1
Tbio
Family: Enzyme
Novelty: 0.04
p_int: 0.947313715
p_ni: 0.052682411
p_wrong: 0.000003874
Score: 0.191
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  1.72

PubMed score by year
PubTator Score  1.48

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDQEPVGGVERGEAVAASGAAAAAAFGESAGQMSNERGFENVELGVIGKKKKVPRRVIHFVSGETMEEYS
1-70
TDEDEVDGLEKKDVLPTVDPTKLTWGPYLWFYMLRAATSTLSVCDFLGEKIASVLGISTPKYQYAIDEYY
70-140
RMKKEEEEEEEENRMSEEAEKQYQQNKLQTDSIVQTDQPETVISSSFVNVNFEMEGDSEVIMESKQNPVS
140-210
VPP
210-213
MDQEPVGGVERGEAVAASGAAAAAAFGESAGQMSNERGFENVELGVIGKKKKVPRRVIHFVSGETMEEYSTDEDEVDGLEKKDVLPTVDPTKLTWGPYLWFYMLRAATSTLSVCDFLGEKIASVLGISTPKYQYAIDEYYRMKKEEEEEEEENRMSEEAEKQYQQNKLQTDSIVQTDQPETVISSSFVNVNFEMEGDSEVIMESKQNPVSVPP