You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MMP21
Matrix metalloproteinase-21

Protein Summary
Description
Plays a specialized role in the generation of left-right asymmetry during embryogenesis. May act as a negative regulator of the NOTCH-signaling pathway (PubMed:26429889, PubMed:26437028). Cleaves alpha-1-antitrypsin (PubMed:12617721). This gene encodes a member of the matrix metalloproteinase family. Proteins in this family are involved in the breakdown of extracellular matrix for both normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, and disease processes, such as asthma and tumor metastasis. The encoded protein may play an important role in embryogenesis, particularly in neuronal cells, as well as in lymphocyte development and survival. [provided by RefSeq, May 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000368808
  • ENSP00000357798
  • ENSG00000154485

Symbol
  • HTX7
  • MMP-21
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.97
molecular function
0.53
cell line
0.47
cell type or tissue
0.47
metabolite
0.45


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9.71   (req: < 5)
Gene RIFs: 16   (req: <= 3)
Antibodies: 84   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9.71   (req: >= 5)
Gene RIFs: 16   (req: > 3)
Antibodies: 84   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (8)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (13)
1 – 10 of 13
CDK13
Tchem
Family: Kinase
Novelty: 0.04248849
Score: 0.9
Data Source: STRINGDB
CDK11A
Tchem
Family: Kinase
Novelty: 0.02871406
Score: 0.748
Data Source: STRINGDB
DBT
Tbio
Family: Enzyme
Novelty: 0.0041813
Score: 0.629
Data Source: STRINGDB
CDK11B
Tchem
Family: Kinase
Novelty: 0.03487219
Score: 0.605
Data Source: STRINGDB
HPX
Tbio
Novelty: 0.00131452
Score: 0.541
Data Source: STRINGDB
EGF
Tbio
Novelty: 0.00015623
Score: 0.466
Data Source: STRINGDB
TIMP4
Tbio
Family: Enzyme
Novelty: 0.00763366
Score: 0.449
Data Source: STRINGDB
FURIN
Tchem
Family: Enzyme
Novelty: 0.00075734
Score: 0.435
Data Source: STRINGDB
TIMP1
Tbio
Family: Enzyme
Novelty: 0.00025759
Score: 0.427
Data Source: STRINGDB
SMC6
Tbio
Novelty: 0.03375388
Score: 0.422
Data Source: STRINGDB
Publication Statistics
PubMed Score  9.71

PubMed score by year
PubTator Score  17.97

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLAASIFRPTLLLCWLAAPWPTQPESLFHSRDRSDLEPSPLRQAKPIADLHAAQRFLSRYGWSGVWAAWG
1-70
PSPEGPPETPKGAALAEAVRRFQRANALPASGELDAATLAAMNRPRCGVPDMRPPPPSAPPSPPGPPPRA
70-140
RSRRSPRAPLSLSRRGWQPRGYPDGGAAQAFSKRTLSWRLLGEALSSQLSVADQRRIVALAFRMWSEVTP
140-210
LDFREDLAAPGAAVDIKLGFGRGRHLGCPRAFDGSGQEFAHAWRLGDIHFDDDEHFTPPTSDTGISLLKV
210-280
AVHEIGHVLGLPHTYRTGSIMQPNYIPQEPAFELDWSDRKAIQKLYGSCEGSFDTAFDWIRKERNQYGEV
280-350
MVRFSTYFFRNSWYWLYENRNNRTRYGDPIQILTGWPGIPTHNIDAFVHIWTWKRDERYFFQGNQYWRYD
350-420
SDKDQALTEDEQGKSYPKLISEGFPGIPSPLDTAFYDRRQKLIYFFKESLVFAFDVNRNRVLNSYPKRIT
420-490
EVFPAVIPQNHPFRNIDSAYYSYAYNSIFFFKGNAYWKVVNDKDKQQNSWLPANGLFPKKFISEKWFDVC
490-560
DVHISTLNM
560-569
MLAASIFRPTLLLCWLAAPWPTQPESLFHSRDRSDLEPSPLRQAKPIADLHAAQRFLSRYGWSGVWAAWGPSPEGPPETPKGAALAEAVRRFQRANALPASGELDAATLAAMNRPRCGVPDMRPPPPSAPPSPPGPPPRARSRRSPRAPLSLSRRGWQPRGYPDGGAAQAFSKRTLSWRLLGEALSSQLSVADQRRIVALAFRMWSEVTPLDFREDLAAPGAAVDIKLGFGRGRHLGCPRAFDGSGQEFAHAWRLGDIHFDDDEHFTPPTSDTGISLLKVAVHEIGHVLGLPHTYRTGSIMQPNYIPQEPAFELDWSDRKAIQKLYGSCEGSFDTAFDWIRKERNQYGEVMVRFSTYFFRNSWYWLYENRNNRTRYGDPIQILTGWPGIPTHNIDAFVHIWTWKRDERYFFQGNQYWRYDSDKDQALTEDEQGKSYPKLISEGFPGIPSPLDTAFYDRRQKLIYFFKESLVFAFDVNRNRVLNSYPKRITEVFPAVIPQNHPFRNIDSAYYSYAYNSIFFFKGNAYWKVVNDKDKQQNSWLPANGLFPKKFISEKWFDVCDVHISTLNM