You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CYP4X1
Cytochrome P450 4X1

Protein Summary
Description
This gene encodes a member of the cytochrome P450 superfamily of enzymes and is located within a cluster of genes belonging to this superfamily on chromosome 1. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The expression pattern of a similar rat protein suggests that this protein may be involved in neurovascular function in the brain. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000371901
  • ENSP00000360968
  • ENSG00000186377

Symbol
  • CYPIVX1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.78
transcription factor perturbation
0.68
molecular function
0.6
PubMedID
0.59
tissue sample
0.57


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.6   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 194   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.6   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 194   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (6)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (11)
1 – 10 of 11
PPFIA1
Tbio
Novelty: 0.02180918
p_int: 0.999925943
p_ni: 0.000074057
Score: 0.394
Data Source: BioPlex,STRINGDB
POR
Tbio
Family: Enzyme
Novelty: 0.00165447
Score: 0.686
Data Source: STRINGDB
CYP4Z1
Tbio
Novelty: 0.07465387
Score: 0.581
Data Source: STRINGDB
PPIG
Tchem
Family: Enzyme
Novelty: 0.00019536
Score: 0.52
Data Source: STRINGDB
CGNL1
Tbio
Novelty: 0.10215791
Score: 0.461
Data Source: STRINGDB
TMOD3
Tbio
Novelty: 0.06428995
Score: 0.441
Data Source: STRINGDB
FA2H
Tbio
Family: Enzyme
Novelty: 0.006234
Score: 0.438
Data Source: STRINGDB
SQLE
Tchem
Family: Enzyme
Novelty: 0.01030355
Score: 0.438
Data Source: STRINGDB
LSS
Tchem
Family: Enzyme
Novelty: 0.00164545
Score: 0.428
Data Source: STRINGDB
UGT2B10
Tbio
Family: Enzyme
Novelty: 0.04187117
Score: 0.424
Data Source: STRINGDB
Publication Statistics
PubMed Score  12.60

PubMed score by year
PubTator Score  5.72

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEFSWLETRWARPFYLAFVFCLALGLLQAIKLYLRRQRLLRDLRPFPAPPTHWFLGHQKFIQDDNMEKLE
1-70
EIIEKYPRAFPFWIGPFQAFFCIYDPDYAKTLLSRTDPKSQYLQKFSPPLLGKGLAALDGPKWFQHRRLL
70-140
TPGFHFNILKAYIEVMAHSVKMMLDKWEKICSTQDTSVEVYEHINSMSLDIIMKCAFSKETNCQTNSTHD
140-210
PYAKAIFELSKIIFHRLYSLLYHSDIIFKLSPQGYRFQKLSRVLNQYTDTIIQERKKSLQAGVKQDNTPK
210-280
RKYQDFLDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNPEHQERCREEVRGIL
280-350
GDGSSITWDQLGEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFPDGCTLPAGITVVLSIWGLHHNPAVW
350-420
KNPKVFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTPDPTRPLTFPNH
420-490
FILKPKNGMYLHLKKLSEC
490-509
MEFSWLETRWARPFYLAFVFCLALGLLQAIKLYLRRQRLLRDLRPFPAPPTHWFLGHQKFIQDDNMEKLEEIIEKYPRAFPFWIGPFQAFFCIYDPDYAKTLLSRTDPKSQYLQKFSPPLLGKGLAALDGPKWFQHRRLLTPGFHFNILKAYIEVMAHSVKMMLDKWEKICSTQDTSVEVYEHINSMSLDIIMKCAFSKETNCQTNSTHDPYAKAIFELSKIIFHRLYSLLYHSDIIFKLSPQGYRFQKLSRVLNQYTDTIIQERKKSLQAGVKQDNTPKRKYQDFLDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNPEHQERCREEVRGILGDGSSITWDQLGEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFPDGCTLPAGITVVLSIWGLHHNPAVWKNPKVFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTPDPTRPLTFPNHFILKPKNGMYLHLKKLSEC