You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
SLC22A15
Solute carrier family 22 member 15

Protein Summary
Description
Probably transports organic cations (By similarity). Appears not to be the agmatine transporter. Organic ion transporters, such as SLC22A15, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).[supplied by OMIM, Apr 2004]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000369502
  • ENSP00000358514
  • ENSG00000163393
  • ENST00000369503
  • ENSP00000358515

Symbol
  • FLIPT1
  • FLIPT1
  • PRO34686
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.73
histone modification site profile
0.69
microRNA
0.55
PubMedID
0.53
tissue sample
0.52


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.27   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 66   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.27   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 66   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (5)
Organic cation transport (R-HSA-549127)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Organic cation transport
Reactome
Organic cation/anion/zwitterion transport
Reactome
SLC-mediated transmembrane transport
Reactome
Transport of bile salts and organic acids, metal ions and amine compounds
Reactome
Transport of small molecules
Name
Explore in Pharos
Explore in Source
Organic cation transport
Organic cation/anion/zwitterion transport
SLC-mediated transmembrane transport
Transport of bile salts and organic acids, metal ions and amine compounds
Transport of small molecules
Gene Ontology Terms (3)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (49)
1 – 10 of 49
ANKRD13C
Tbio
Novelty: 1.81818182
p_int: 0.999986677
p_ni: 0.000008306
p_wrong: 0.000005017
Data Source: BioPlex
VAPA
Tbio
Novelty: 0.0022428
p_int: 0.999977975
p_ni: 0.000022025
Data Source: BioPlex
ERGIC2
Tbio
Novelty: 0.12696493
p_int: 0.999830799
p_ni: 0.000169199
p_wrong: 2e-9
Data Source: BioPlex
GHDC
Tbio
Novelty: 0.14562067
p_int: 0.999747748
p_ni: 0.000252252
Data Source: BioPlex
VAPB
Tbio
Novelty: 0.00566042
p_int: 0.999555254
p_ni: 0.000444746
Data Source: BioPlex
ZFPL1
Tbio
Novelty: 0.06292606
p_int: 0.998274541
p_ni: 0.001648662
p_wrong: 0.000076798
Data Source: BioPlex
DPY19L4
Tdark
Family: Enzyme
Novelty: 4
p_int: 0.98139111
p_ni: 0.018182299
p_wrong: 0.000426591
Data Source: BioPlex
GUF1
Tbio
Novelty: 0.00666297
p_int: 0.975108235
p_ni: 0.024167658
p_wrong: 0.000724107
Data Source: BioPlex
LMBRD2
Tdark
Novelty: 3
p_int: 0.962234967
p_ni: 0.034331621
p_wrong: 0.003433413
Data Source: BioPlex
CNNM1
Tdark
Novelty: 0.16670044
p_int: 0.96086658
p_ni: 0.039131745
p_wrong: 0.000001675
Data Source: BioPlex
Publication Statistics
PubMed Score  1.27

PubMed score by year
PubTator Score  1

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEVEEAFQAVGEMGIYQMYLCFLLAVLLQLYVATEAILIALVGATPSYHWDLAELLPNQSHGNQSAGEDQ
1-70
AFGDWLLTANGSEIHKHVHFSSSFTSIASEWFLIANRSYKVSAASSFFFSGVFVGVISFGQLSDRFGRKK
70-140
VYLTGFALDILFAIANGFSPSYEFFAVTRFLVGMMNGGMSLVAFVLLNECVGTAYWALAGSIGGLFFAVG
140-210
IAQYALLGYFIRSWRTLAILVNLQGTVVFLLSLFIPESPRWLYSQGRLSEAEEALYLIAKRNRKLKCTFS
210-280
LTHPANRSCRETGSFLDLFRYRVLLGHTLILMFIWFVCSLVYYGLTLSAGDLGGSIYANLALSGLIEIPS
280-350
YPLCIYLINQKWFGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGKLTISAAFNIVYI
350-420
YTSELYPTVIRNVGLGTCSMFSRVGGIIAPFIPSLKYVQWSLPFIVFGATGLTSGLLSLLLPETLNSPLL
420-490
ETFSDLQVYSYRRLGEEALSLQALDPQQCVDKESSLGSESEEEEEFYDADEETQMIK
490-547
MEVEEAFQAVGEMGIYQMYLCFLLAVLLQLYVATEAILIALVGATPSYHWDLAELLPNQSHGNQSAGEDQAFGDWLLTANGSEIHKHVHFSSSFTSIASEWFLIANRSYKVSAASSFFFSGVFVGVISFGQLSDRFGRKKVYLTGFALDILFAIANGFSPSYEFFAVTRFLVGMMNGGMSLVAFVLLNECVGTAYWALAGSIGGLFFAVGIAQYALLGYFIRSWRTLAILVNLQGTVVFLLSLFIPESPRWLYSQGRLSEAEEALYLIAKRNRKLKCTFSLTHPANRSCRETGSFLDLFRYRVLLGHTLILMFIWFVCSLVYYGLTLSAGDLGGSIYANLALSGLIEIPSYPLCIYLINQKWFGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGKLTISAAFNIVYIYTSELYPTVIRNVGLGTCSMFSRVGGIIAPFIPSLKYVQWSLPFIVFGATGLTSGLLSLLLPETLNSPLLETFSDLQVYSYRRLGEEALSLQALDPQQCVDKESSLGSESEEEEEFYDADEETQMIK