You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RASEF
Ras and EF-hand domain-containing protein

Protein Summary
Description
Binds predominantly GDP, and also GTP. This gene is a member of the Rab family of GTPases that are involved in regulation of membrane traffic. The encoded protein contains an N-terminal EF-hand domain, a coiled-coil motif and a C-terminal Rab domain. A potential role as tumor suppressor has been indicated for this gene. [provided by RefSeq, Nov 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000340717
  • ENSP00000345651
  • ENSG00000165105
  • ENST00000376447
  • ENSP00000365630

Symbol
  • RAB45
  • RAB45
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.94
protein domain
0.92
gene perturbation
0.81
tissue sample
0.6
cell type or tissue
0.57


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7.51   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 82   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7.51   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 82   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (8)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (54)
1 – 10 of 54
GDI1
Tbio
Novelty: 0.02210681
p_int: 0.999999466
p_ni: 7.3e-8
p_wrong: 4.61e-7
Score: 0.551
Data Source: BioPlex,STRINGDB
UHRF1BP1
Tbio
Novelty: 0.42352941
p_int: 0.999999247
p_ni: 7.36e-7
p_wrong: 1.7e-8
Data Source: BioPlex
RABL2B
Tdark
Family: Enzyme
Novelty: 0.23346304
p_int: 0.999998222
p_ni: 0.00000162
p_wrong: 1.58e-7
Score: 0.705
Data Source: BioPlex,STRINGDB
CHML
Tbio
Family: Enzyme
Novelty: 0.0116075
p_int: 0.999985773
p_ni: 0.000014089
p_wrong: 1.37e-7
Score: 0.352
Data Source: BioPlex,STRINGDB
FAM9C
Tdark
Novelty: 1.42857143
p_int: 0.999983721
p_ni: 0.000016277
p_wrong: 2e-9
Data Source: BioPlex
CHM
Tbio
Family: Enzyme
Novelty: 0.00301194
p_int: 0.999939728
p_ni: 0.00006027
p_wrong: 2e-9
Score: 0.337
Data Source: BioPlex,STRINGDB
SRC
Tclin
Family: Kinase
Novelty: 0.00009742
p_int: 0.999576873
p_ni: 0.000423127
Data Source: BioPlex
ITPR2
Tbio
Family: IC
Novelty: 0.0094474
p_int: 0.999473021
p_ni: 0.000526979
Data Source: BioPlex
UHRF1BP1L
Tbio
Novelty: 0.57142857
p_int: 0.998862263
p_ni: 0.001137736
p_wrong: 1e-9
Data Source: BioPlex
DYNC1LI2
Tbio
Novelty: 0.32608696
p_int: 0.998383363
p_ni: 0.001616637
Data Source: BioPlex
Publication Statistics
PubMed Score  7.51

PubMed score by year
PubTator Score  4.52

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEADGDGEELARLRSVFAACDANRSGRLEREEFRALCTELRVRPADAEAVFQRLDADRDGAITFQEFARG
1-70
FLGSLRGGRRRDWGPLDPAPAVSEAGPETHDSEEDEGDEDAAAALATSCGPASPGRAWQDFQARLGDEAK
70-140
FIPREEQVSTLYQNINLVEPRLIQPYEHVIKNFIREIRLQSTEMENLAIAVKRAQDKAAMQLSELEEEMD
140-210
QRIQAAEHKTRKDEKRKAEEALSDLRRQYETEVGDLQVTIKKLRKLEEQSKRVSQKEDVAALKKQIYDLS
210-280
MENQKVKKDLLEAQTNIAFLQSELDALKSDYADQSLNTERDLEIIRAYTEDRNSLERQIEILQTANRKLH
280-350
DSNDGLRSALENSYSKFNRSLHINNISPGNTISRSSPKFIGHSPQPLGYDRSSRSSYVDEDCDSLALCDP
350-420
LQRTNCEVDSLPESCFDSGLSTLRDPNEYDSEVEYKHQRGFQRSHGVQESFGGDASDTDVPDIRDEETFG
420-490
LEDVASVLDWKPQGSVSEGSIVSSSRKPISALSPQTDLVDDNAKSFSSQKAYKIVLAGDAAVGKSSFLMR
490-560
LCKNEFRENISATLGVDFQMKTLIVDGERTVLQLWDTAGQERFRSIAKSYFRKADGVLLLYDVTCEKSFL
560-630
NIREWVDMIEDAAHETVPIMLVGNKADIRDTAATEGQKCVPGHFGEKLAMTYGALFCETSAKDGSNIVEA
630-700
VLHLAREVKKRTDKDDSRSITNLTGTNSKKSPQMKNCCNG
700-740
MEADGDGEELARLRSVFAACDANRSGRLEREEFRALCTELRVRPADAEAVFQRLDADRDGAITFQEFARGFLGSLRGGRRRDWGPLDPAPAVSEAGPETHDSEEDEGDEDAAAALATSCGPASPGRAWQDFQARLGDEAKFIPREEQVSTLYQNINLVEPRLIQPYEHVIKNFIREIRLQSTEMENLAIAVKRAQDKAAMQLSELEEEMDQRIQAAEHKTRKDEKRKAEEALSDLRRQYETEVGDLQVTIKKLRKLEEQSKRVSQKEDVAALKKQIYDLSMENQKVKKDLLEAQTNIAFLQSELDALKSDYADQSLNTERDLEIIRAYTEDRNSLERQIEILQTANRKLHDSNDGLRSALENSYSKFNRSLHINNISPGNTISRSSPKFIGHSPQPLGYDRSSRSSYVDEDCDSLALCDPLQRTNCEVDSLPESCFDSGLSTLRDPNEYDSEVEYKHQRGFQRSHGVQESFGGDASDTDVPDIRDEETFGLEDVASVLDWKPQGSVSEGSIVSSSRKPISALSPQTDLVDDNAKSFSSQKAYKIVLAGDAAVGKSSFLMRLCKNEFRENISATLGVDFQMKTLIVDGERTVLQLWDTAGQERFRSIAKSYFRKADGVLLLYDVTCEKSFLNIREWVDMIEDAAHETVPIMLVGNKADIRDTAATEGQKCVPGHFGEKLAMTYGALFCETSAKDGSNIVEAVLHLAREVKKRTDKDDSRSITNLTGTNSKKSPQMKNCCNG