You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
OSCAR
Osteoclast-associated immunoglobulin-like receptor

Protein Summary
Description
Regulator of osteoclastogenesis which plays an important bone-specific function in osteoclast differentiation. Osteoclasts are multinucleated cells that resorb bone and are essential for bone homeostasis. This gene encodes an osteoclast-associated receptor (OSCAR), which is a member of the leukocyte receptor complex protein family that plays critical roles in the regulation of both innate and adaptive immune responses. The encoded protein may play a role in oxidative stress-mediated atherogenesis as well as monocyte adhesion. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000284648
  • ENSP00000365808
  • ENSG00000170909
  • ENST00000391761
  • ENSP00000375641
  • ENST00000610577
  • ENSP00000478594
  • ENSG00000276982
  • ENST00000610915
  • ENSP00000479317
  • ENSG00000277088
  • ENST00000610985
  • ENSP00000484755
  • ENSG00000274703
  • ENST00000611143
  • ENSP00000477994
  • ENSG00000278533
  • ENST00000611480
  • ENSP00000480193
  • ENSG00000275551
  • ENST00000611535
  • ENSP00000483744
  • ENSG00000275736
  • ENST00000611715
  • ENSP00000478382
  • ENST00000611719
  • ENSP00000478099
  • ENSG00000275644
  • ENST00000611918
  • ENSP00000482460
  • ENST00000611987
  • ENSP00000478027
  • ENST00000612289
  • ENSP00000482414
  • ENST00000612406
  • ENSP00000478224
  • ENSG00000273511
  • ENST00000612953
  • ENSP00000479954
  • ENST00000613426
  • ENSP00000480900
  • ENST00000613814
  • ENSP00000484125
  • ENST00000614003
  • ENSP00000481647
  • ENST00000614380
  • ENSP00000482734
  • ENST00000615074
  • ENSP00000477845
  • ENST00000615546
  • ENSP00000482402
  • ENST00000616215
  • ENSP00000479628
  • ENST00000616227
  • ENSP00000479849
  • ENST00000616232
  • ENSP00000484567
  • ENST00000616461
  • ENSP00000482610
  • ENST00000616758
  • ENSP00000481785
  • ENST00000617187
  • ENSP00000481805
  • ENST00000617210
  • ENSP00000482359
  • ENSG00000278378
  • ENST00000617622
  • ENSP00000480863
  • ENST00000617834
  • ENSP00000481147
  • ENST00000617993
  • ENSP00000481261
  • ENST00000618710
  • ENSP00000484323
  • ENST00000619170
  • ENSP00000482545
  • ENST00000619287
  • ENSP00000484977
  • ENST00000619631
  • ENSP00000484878
  • ENST00000620283
  • ENSP00000483090
  • ENST00000620647
  • ENSP00000478216
  • ENST00000621284
  • ENSP00000477825
  • ENST00000621290
  • ENSP00000482791
  • ENST00000621328
  • ENSP00000482997
  • ENST00000621506
  • ENSP00000480424
  • ENST00000621788
  • ENSP00000481926
  • ENST00000622288
  • ENSP00000484602
  • ENST00000622326
  • ENSP00000481257

Symbol
  • PIGR3
  • PIgR-3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell line
0.64
tissue sample
0.63
tissue
0.59
histone modification site profile
0.58
transcription factor
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 313.16   (req: < 5)
Gene RIFs: 19   (req: <= 3)
Antibodies: 221   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 313.16   (req: >= 5)
Gene RIFs: 19   (req: > 3)
Antibodies: 221   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (7)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Immune System
Reactome
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Reactome
Innate Immune System
Reactome
Neutrophil degranulation
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Immune System
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Innate Immune System
Neutrophil degranulation
Gene Ontology Terms (10)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Protein-Protein Interactions (121)
1 – 10 of 121
MMP9
Tchem
Family: Enzyme
Novelty: 0.00010127
Score: 0.936
Data Source: STRINGDB
RETN
Tbio
Novelty: 0.00076494
Score: 0.926
Data Source: STRINGDB
FOLR3
Tbio
Novelty: 0.14963982
Score: 0.924
Data Source: STRINGDB
CFP
Tbio
Novelty: 0.00062861
Score: 0.913
Data Source: STRINGDB
PPBP
Tbio
Novelty: 0.00058824
Score: 0.911
Data Source: STRINGDB
LYZ
Tbio
Family: Enzyme
Novelty: 0.00100348
Score: 0.91
Data Source: STRINGDB
DOCK2
Tbio
Novelty: 0.02066566
Score: 0.909
Data Source: STRINGDB
CTSS
Tchem
Family: Enzyme
Novelty: 0.00788672
Score: 0.909
Data Source: STRINGDB
PTPN6
Tchem
Family: Enzyme
Novelty: 0.00619412
Score: 0.908
Data Source: STRINGDB
CDA
Tchem
Family: Enzyme
Novelty: 0.00243009
Score: 0.907
Data Source: STRINGDB
Publication Statistics
PubMed Score  313.16

PubMed score by year
PubTator Score  3

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MALVLILQLLTLWPLCHTDITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEI
1-70
APLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVV
70-140
GPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRS
140-210
EVLVISWEGEGPEARPASSAPGMQAPGPPPSDPGAQAPSLSSFRPRGLVLQPLLPQTQDSWDPAPPPSDP
210-280
GV
280-282
MALVLILQLLTLWPLCHTDITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEGEGPEARPASSAPGMQAPGPPPSDPGAQAPSLSSFRPRGLVLQPLLPQTQDSWDPAPPPSDPGV