You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
PM20D2
Peptidase M20 domain-containing protein 2

Protein Classes
IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 102   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 102   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (4)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Protein-Protein Interactions (38)
1 – 10 of 38
GPSM3
Tbio
Novelty: 0.0098187
p_int: 0.99984709
p_ni: 0.00015291
Data Source: BioPlex
HAO2
Tchem
Family: Enzyme
Novelty: 0.05085077
p_int: 0.999430132
p_ni: 0.000569868
Score: 0.175
Data Source: BioPlex,STRINGDB
DEFB1
Tbio
Novelty: 0.0020205
p_int: 0.995213617
p_ni: 0.004786383
Score: 0.228
Data Source: BioPlex,STRINGDB
ANGPTL4
Tbio
Novelty: 0.00295835
p_int: 0.991501179
p_ni: 0.008498821
Score: 0.228
Data Source: BioPlex,STRINGDB
KIAA1671
Tdark
Novelty: 3.11450382
p_int: 0.947669009
p_ni: 0.05233089
p_wrong: 1.01e-7
Score: 0.188
Data Source: BioPlex,STRINGDB
SPATA2
Tbio
Novelty: 0.12189223
p_int: 0.932552552
p_ni: 0.067447448
Data Source: BioPlex
LNP1
Tdark
Novelty: 0.00958233
p_int: 0.909373844
p_ni: 0.090626156
Data Source: BioPlex
PRIM2
Tbio
Family: Enzyme
Novelty: 0.08227878
p_int: 0.879065905
p_ni: 0.120789866
p_wrong: 0.00014423
Score: 0.239
Data Source: BioPlex,STRINGDB
TK1
Tchem
Family: Kinase
Novelty: 0.00217122
p_int: 0.802131713
p_ni: 0.197868286
p_wrong: 1e-9
Score: 0.326
Data Source: BioPlex,STRINGDB
SRSF12
Tbio
Novelty: 0.8
Score: 0.752
Data Source: STRINGDB
Publication Statistics
PubMed Score  1.00

PubMed score by year
PubTator Score  0.5

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRPGGERPVEGGACNGRSELELLKLRSAECIDEAAERLGALSRAIWSQPELAYEEHHAHRVLTHFFEREP
1-70
PAASWAVQPHYQLPTAFRAEWEPPEARAPSATPRPLHLGFLCEYDALPGIGHACGHNLIAEVGAAAALGV
70-140
RGALEGLPRPPPPVKVVVLGTPAEEDGGGKIDLIEAGAFTNLDVVFMAHPSQENAAYLPDMAEHDVTVKY
140-210
YGKASHSASYPWEGLNALDAAVLAYNNLSVFRQQMKPTWRVHGIIKNGGVKPNIIPSYSELIYYFRAPSM
210-280
KELQVLTKKAEDCFRAAALASGCTVEIKGGAHDYYNVLPNKSLWKAYMENGRKLGIEFISEDTMLNGPSG
280-350
STDFGNVSFVVPGIHPYFHIGSNALNHTEQYTEAAGSQEAQFYTLRTAKALAMTALDVIFKPELLEGIRE
350-420
DFKLKLQEEQFVNAVE
420-436
MRPGGERPVEGGACNGRSELELLKLRSAECIDEAAERLGALSRAIWSQPELAYEEHHAHRVLTHFFEREPPAASWAVQPHYQLPTAFRAEWEPPEARAPSATPRPLHLGFLCEYDALPGIGHACGHNLIAEVGAAAALGVRGALEGLPRPPPPVKVVVLGTPAEEDGGGKIDLIEAGAFTNLDVVFMAHPSQENAAYLPDMAEHDVTVKYYGKASHSASYPWEGLNALDAAVLAYNNLSVFRQQMKPTWRVHGIIKNGGVKPNIIPSYSELIYYFRAPSMKELQVLTKKAEDCFRAAALASGCTVEIKGGAHDYYNVLPNKSLWKAYMENGRKLGIEFISEDTMLNGPSGSTDFGNVSFVVPGIHPYFHIGSNALNHTEQYTEAAGSQEAQFYTLRTAKALAMTALDVIFKPELLEGIREDFKLKLQEEQFVNAVE