You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SUPV3L1
ATP-dependent RNA helicase SUPV3L1, mitochondrial

Protein Summary
Description
Major helicase player in mitochondrial RNA metabolism. Component of the mitochondrial degradosome (mtEXO) complex, that degrades 3' overhang double-stranded RNA with a 3'-to-5' directionality in an ATP-dependent manner. ATPase and ATP-dependent multisubstrate helicase, able to unwind double-stranded (ds) DNA and RNA, and RNA/DNA heteroduplexes in the 5'-to-3' direction. Plays a role in the RNA surveillance system in mitochondria; regulates the stability of mature mRNAs, the removal of aberrantly formed mRNAs and the rapid degradation of non coding processing intermediates. Also implicated in recombination and chromatin maintenance pathways. May protect cells from apoptosis. Associates with mitochondrial DNA.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000359655
  • ENSP00000352678
  • ENSG00000156502

Symbol
  • SUV3
  • SUV3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
1
interacting protein
0.95
histone modification site profile
0.91
disease perturbation
0.9
transcription factor binding site profile
0.82


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 68.24   (req: < 5)
Gene RIFs: 14   (req: <= 3)
Antibodies: 122   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 68.24   (req: >= 5)
Gene RIFs: 14   (req: > 3)
Antibodies: 122   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 22
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (27)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (114)
1 – 10 of 114
ELAVL2
Tbio
Novelty: 0.0071859
p_int: 0.997625698
p_ni: 0.002374302
Data Source: BioPlex
MRPS11
Tdark
Novelty: 0.64495732
p_int: 0.995188553
p_ni: 0.004811447
Score: 0.235
Data Source: BioPlex,STRINGDB
HNRNPDL
Tbio
Novelty: 0.00261778
p_int: 0.992605418
p_ni: 0.007394582
Score: 0.194
Data Source: BioPlex,STRINGDB
RBM3
Tbio
Novelty: 0.01332989
p_int: 0.992263846
p_ni: 0.007736154
Score: 0.19
Data Source: BioPlex,STRINGDB
MRPS17
Tdark
Novelty: 1.18644068
p_int: 0.990573321
p_ni: 0.00942667
p_wrong: 9e-9
Score: 0.191
Data Source: BioPlex,STRINGDB
PNPT1
Tbio
Family: Enzyme
Novelty: 0.00369781
p_int: 0.988759077
p_ni: 0.007531329
p_wrong: 0.003709595
Score: 0.994
Data Source: BioPlex,STRINGDB
MRPS18B
Tbio
Novelty: 0.173543
p_int: 0.984030853
p_ni: 0.015965461
p_wrong: 0.000003686
Data Source: BioPlex
MRPS34
Tbio
Novelty: 0.29370629
p_int: 0.977582909
p_ni: 0.022417091
Data Source: BioPlex
CIRBP
Tbio
Novelty: 0.00581
p_int: 0.97241333
p_ni: 0.027545459
p_wrong: 0.000041211
Data Source: BioPlex
DDX54
Tbio
Family: Enzyme
Novelty: 0.10631117
p_int: 0.964968364
p_ni: 0.035027607
p_wrong: 0.000004028
Score: 0.464
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  68.24

PubMed score by year
PubTator Score  36.21

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSFSRALLWARLPAGRQAGHRAAICSALRPHFGPFPGVLGQVSVLATASSSASGGSKIPNTSLFVPLTVK
1-70
PQGPSADGDVGAELTRPLDKNEVKKVLDKFYKRKEIQKLGADYGLDARLFHQAFISFRNYIMQSHSLDVD
70-140
IHIVLNDICFGAAHADDLFPFFLRHAKQIFPVLDCKDDLRKISDLRIPPNWYPDARAMQRKIIFHSGPTN
140-210
SGKTYHAIQKYFSAKSGVYCGPLKLLAHEIFEKSNAAGVPCDLVTGEERVTVQPNGKQASHVSCTVEMCS
210-280
VTTPYEVAVIDEIQMIRDPARGWAWTRALLGLCAEEVHLCGEPAAIDLVMELMYTTGEEVEVRDYKRLTP
280-350
ISVLDHALESLDNLRPGDCIVCFSKNDIYSVSRQIEIRGLESAVIYGSLPPGTKLAQAKKFNDPNDPCKI
350-420
LVATDAIGMGLNLSIRRIIFYSLIKPSINEKGERELEPITTSQALQIAGRAGRFSSRFKEGEVTTMNHED
420-490
LSLLKEILKRPVDPIRAAGLHPTAEQIEMFAYHLPDATLSNLIDIFVDFSQVDGQYFVCNMDDFKFSAEL
490-560
IQHIPLSLRVRYVFCTAPINKKQPFVCSSLLQFARQYSRNEPLTFAWLRRYIKWPLLPPKNIKDLMDLEA
560-630
VHDVLDLYLWLSYRFMDMFPDASLIRDLQKELDGIIQDGVHNITKLIKMSETHKLLNLEGFPSGSQSRLS
630-700
GTLKSQARRTRGTKALGSKATEPPSPDAGELSLASRLVQQGLLTPDMLKQLEKEWMTQQTEHNKEKTESG
700-770
THPKGTRRKKKEPDSD
770-786
MSFSRALLWARLPAGRQAGHRAAICSALRPHFGPFPGVLGQVSVLATASSSASGGSKIPNTSLFVPLTVKPQGPSADGDVGAELTRPLDKNEVKKVLDKFYKRKEIQKLGADYGLDARLFHQAFISFRNYIMQSHSLDVDIHIVLNDICFGAAHADDLFPFFLRHAKQIFPVLDCKDDLRKISDLRIPPNWYPDARAMQRKIIFHSGPTNSGKTYHAIQKYFSAKSGVYCGPLKLLAHEIFEKSNAAGVPCDLVTGEERVTVQPNGKQASHVSCTVEMCSVTTPYEVAVIDEIQMIRDPARGWAWTRALLGLCAEEVHLCGEPAAIDLVMELMYTTGEEVEVRDYKRLTPISVLDHALESLDNLRPGDCIVCFSKNDIYSVSRQIEIRGLESAVIYGSLPPGTKLAQAKKFNDPNDPCKILVATDAIGMGLNLSIRRIIFYSLIKPSINEKGERELEPITTSQALQIAGRAGRFSSRFKEGEVTTMNHEDLSLLKEILKRPVDPIRAAGLHPTAEQIEMFAYHLPDATLSNLIDIFVDFSQVDGQYFVCNMDDFKFSAELIQHIPLSLRVRYVFCTAPINKKQPFVCSSLLQFARQYSRNEPLTFAWLRRYIKWPLLPPKNIKDLMDLEAVHDVLDLYLWLSYRFMDMFPDASLIRDLQKELDGIIQDGVHNITKLIKMSETHKLLNLEGFPSGSQSRLSGTLKSQARRTRGTKALGSKATEPPSPDAGELSLASRLVQQGLLTPDMLKQLEKEWMTQQTEHNKEKTESGTHPKGTRRKKKEPDSD