You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SLC15A3
Solute carrier family 15 member 3

Protein Summary
Description
Proton oligopeptide cotransporter. Transports free histidine and certain di- and tripeptides (By similarity).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000227880
  • ENSP00000227880
  • ENSG00000110446

Symbol
  • OCTP
  • PHT2
  • PTR3
  • OCTP
  • PHT2
  • PTR3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
1
histone modification site profile
0.7
tissue sample
0.7
cellular component
0.67
tissue
0.63


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 25.2   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 97   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 25.2   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 97   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (4)
Proton/oligopeptide cotransporters (R-HSA-427975)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Proton/oligopeptide cotransporters
Reactome
SLC-mediated transmembrane transport
Reactome
Transport of inorganic cations/anions and amino acids/oligopeptides
Reactome
Transport of small molecules
Name
Explore in Pharos
Explore in Source
Proton/oligopeptide cotransporters
SLC-mediated transmembrane transport
Transport of inorganic cations/anions and amino acids/oligopeptides
Transport of small molecules
Protein-Protein Interactions (29)
1 – 10 of 29
CD6
Tbio
Novelty: 0.00254096
Score: 0.756
Data Source: STRINGDB
TYROBP
Tbio
Family: Enzyme
Novelty: 0.00522854
Score: 0.67
Data Source: STRINGDB
CD5
Tbio
Novelty: 0.00043341
Score: 0.654
Data Source: STRINGDB
NOD2
Tclin
Novelty: 0.00070751
Score: 0.63
Data Source: STRINGDB
SLC37A2
Tbio
Family: Transporter
Novelty: 0.13078784
Score: 0.587
Data Source: STRINGDB
IFI30
Tbio
Family: Enzyme
Novelty: 0.00132842
Score: 0.575
Data Source: STRINGDB
CSF1R
Tclin
Family: Kinase
Novelty: 0.00058475
Score: 0.565
Data Source: STRINGDB
PTCHD3
Tbio
Novelty: 0.00118764
Score: 0.543
Data Source: STRINGDB
LILRB2
Tbio
Novelty: 0.00812824
Score: 0.533
Data Source: STRINGDB
CD14
Tbio
Novelty: 0.01019035
Score: 0.529
Data Source: STRINGDB
Publication Statistics
PubMed Score  25.20

PubMed score by year
PubTator Score  12.11

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPAPRAREQPRVPGERQPLLPRGARGPRRWRRAAGAAVLLVEMLERAAFFGVTANLVLYLNSTNFNWTGE
1-70
QATRAALVFLGASYLLAPVGGWLADVYLGRYRAVALSLLLYLAASGLLPATAFPDGRSSFCGEMPASPLG
70-140
PACPSAGCPRSSPSPYCAPVLYAGLLLLGLAASSVRSNLTSFGADQVMDLGRDATRRFFNWFYWSINLGA
140-210
VLSLLVVAFIQQNISFLLGYSIPVGCVGLAFFIFLFATPVFITKPPMGSQVSSMLKLALQNCCPQLWQRH
210-280
SARDRQCARVLADERSPQPGASPQEDIANFQVLVKILPVMVTLVPYWMVYFQMQSTYVLQGLHLHIPNIF
280-350
PANPANISVALRAQGSSYTIPEAWLLLANVVVVLILVPLKDRLIDPLLLRCKLLPSALQKMALGMFFGFT
350-420
SVIVAGVLEMERLHYIHHNETVSQQIGEVLYNAAPLSIWWQIPQYLLIGISEIFASIPGLEFAYSEAPRS
420-490
MQGAIMGIFFCLSGVGSLLGSSLVALLSLPGGWLHCPKDFGNINNCRMDLYFFLLAGIQAVTALLFVWIA
490-560
GRYERASQGPASHSRFSRDRG
560-581
MPAPRAREQPRVPGERQPLLPRGARGPRRWRRAAGAAVLLVEMLERAAFFGVTANLVLYLNSTNFNWTGEQATRAALVFLGASYLLAPVGGWLADVYLGRYRAVALSLLLYLAASGLLPATAFPDGRSSFCGEMPASPLGPACPSAGCPRSSPSPYCAPVLYAGLLLLGLAASSVRSNLTSFGADQVMDLGRDATRRFFNWFYWSINLGAVLSLLVVAFIQQNISFLLGYSIPVGCVGLAFFIFLFATPVFITKPPMGSQVSSMLKLALQNCCPQLWQRHSARDRQCARVLADERSPQPGASPQEDIANFQVLVKILPVMVTLVPYWMVYFQMQSTYVLQGLHLHIPNIFPANPANISVALRAQGSSYTIPEAWLLLANVVVVLILVPLKDRLIDPLLLRCKLLPSALQKMALGMFFGFTSVIVAGVLEMERLHYIHHNETVSQQIGEVLYNAAPLSIWWQIPQYLLIGISEIFASIPGLEFAYSEAPRSMQGAIMGIFFCLSGVGSLLGSSLVALLSLPGGWLHCPKDFGNINNCRMDLYFFLLAGIQAVTALLFVWIAGRYERASQGPASHSRFSRDRG