You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ADHFE1
Hydroxyacid-oxoacid transhydrogenase, mitochondrial

Protein Summary
Description
Catalyzes the cofactor-independent reversible oxidation of gamma-hydroxybutyrate (GHB) to succinic semialdehyde (SSA) coupled to reduction of 2-ketoglutarate (2-KG) to D-2-hydroxyglutarate (D-2-HG). D,L-3-hydroxyisobutyrate and L-3-hydroxybutyrate (L-3-OHB) are also substrates for HOT with 10-fold lower activities. The ADHFE1 gene encodes hydroxyacid-oxoacid transhydrogenase (EC 1.1.99.24), which is responsible for the oxidation of 4-hydroxybutyrate in mammalian tissues (Kardon et al., 2006 [PubMed 16616524]).[supplied by OMIM, Mar 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000396623
  • ENSP00000379865
  • ENSG00000147576
  • ENST00000415254
  • ENSP00000407115
  • ENST00000424777
  • ENSP00000410883

Symbol
  • HOT
  • ADH8
  • HMFT2263
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.87
gene perturbation
0.65
pathway
0.65
virus perturbation
0.64
kinase perturbation
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 26.04   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 107   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 26.04   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 107   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (14)
Interconversion of 2-oxoglutarate and 2-hydroxyglutarate (R-HSA-880009)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Interconversion of 2-oxoglutarate and 2-hydroxyglutarate
Reactome
Metabolism
Reactome
Pyruvate metabolism and Citric Acid (TCA) cycle
Reactome
The citric acid (TCA) cycle and respiratory electron transport
Name
Explore in Pharos
Explore in Source
Interconversion of 2-oxoglutarate and 2-hydroxyglutarate
Metabolism
Pyruvate metabolism and Citric Acid (TCA) cycle
The citric acid (TCA) cycle and respiratory electron transport
Protein-Protein Interactions (89)
1 – 10 of 89
ADH5
Tchem
Family: Enzyme
Novelty: 0.00291577
Score: 0.92
Data Source: STRINGDB
ECHS1
Tbio
Family: Enzyme
Novelty: 0.01956365
Score: 0.886
Data Source: STRINGDB
ALDH8A1
Tbio
Family: Enzyme
Novelty: 0.22973835
Score: 0.763
Data Source: STRINGDB
ADH7
Tchem
Family: Enzyme
Novelty: 0.0066812
Score: 0.754
Data Source: STRINGDB
ADH4
Tbio
Family: Enzyme
Novelty: 0.0042593
Score: 0.73
Data Source: STRINGDB
ADH6
Tbio
Family: Enzyme
Novelty: 0.01675363
Score: 0.725
Data Source: STRINGDB
ALDH6A1
Tbio
Family: Enzyme
Novelty: 0.05651741
Score: 0.723
Data Source: STRINGDB
ADH1A
Tclin
Family: Enzyme
Novelty: 0.00278351
Score: 0.7
Data Source: STRINGDB
ECHDC1
Tbio
Family: Enzyme
Novelty: 0.00630899
Score: 0.686
Data Source: STRINGDB
VCPIP1
Tbio
Novelty: 0.14789734
Score: 0.679
Data Source: STRINGDB
Publication Statistics
PubMed Score  26.04

PubMed score by year
PubTator Score  197.28

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAAARARVAYLLRQLQRAACQCPTHSHTYSQAPGLSPSGKTTDYAFEMAVSNIRYGAAVTKEVGMDLKN
1-70
MGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDSSFMEAIEFAQKGAFDAYVAVGGG
70-140
STMDTCKAANLYASSPHSDFLDYVSAPIGKGKPVSVPLKPLIAVPTTSGTGSETTGVAIFDYEHLKVKIG
140-210
ITSRAIKPTLGLIDPLHTLHMPARVVANSGFDVLCHALESYTTLPYHLRSPCPSNPITRPAYQGSNPISD
210-280
IWAIHALRIVAKYLKRAVRNPDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKMYKAKDYNV
280-350
DHPLVPHGLSVVLTSPAVFTFTAQMFPERHLEMAEILGADTRTARIQDAGLVLADTLRKFLFDLDVDDGL
350-420
AAVGYSKADIPALVKGTLPQERVTKLAPCPQSEEDLAALFEASMKLY
420-467
MAAAARARVAYLLRQLQRAACQCPTHSHTYSQAPGLSPSGKTTDYAFEMAVSNIRYGAAVTKEVGMDLKNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDSSFMEAIEFAQKGAFDAYVAVGGGSTMDTCKAANLYASSPHSDFLDYVSAPIGKGKPVSVPLKPLIAVPTTSGTGSETTGVAIFDYEHLKVKIGITSRAIKPTLGLIDPLHTLHMPARVVANSGFDVLCHALESYTTLPYHLRSPCPSNPITRPAYQGSNPISDIWAIHALRIVAKYLKRAVRNPDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKMYKAKDYNVDHPLVPHGLSVVLTSPAVFTFTAQMFPERHLEMAEILGADTRTARIQDAGLVLADTLRKFLFDLDVDDGLAAVGYSKADIPALVKGTLPQERVTKLAPCPQSEEDLAALFEASMKLY