You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SERPINA12
Serpin A12

Protein Summary
Description
Adipokine that modulates insulin action by specifically inhibiting its target protease KLK7 in white adipose tissues.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000341228
  • ENSP00000342109
  • ENSG00000165953
  • ENST00000556881
  • ENSP00000451738

Symbol
  • OL-64
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.78
biological term
0.68
biological process
0.54
cell line
0.53
protein complex
0.48


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 196.2   (req: < 5)
Gene RIFs: 110   (req: <= 3)
Antibodies: 336   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 196.2   (req: >= 5)
Gene RIFs: 110   (req: > 3)
Antibodies: 336   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (10)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (79)
1 – 10 of 79
SUSD5
Tdark
Novelty: 3
p_int: 0.999986778
p_ni: 0.000005254
p_wrong: 0.000007967
Data Source: BioPlex
KIAA1549
Tbio
Novelty: 0.01648616
p_int: 0.999959661
p_ni: 0.000037591
p_wrong: 0.000002749
Data Source: BioPlex
LAMB1
Tbio
Novelty: 0.01303566
p_int: 0.999900328
p_ni: 0.000099672
Score: 0.158
Data Source: BioPlex,STRINGDB
CTAGE5
Tbio
Novelty: 0.06289332
p_int: 0.999828982
p_ni: 0.000171007
p_wrong: 1.1e-8
Score: 0.167
Data Source: BioPlex,STRINGDB
FCF1
Tdark
Novelty: 0.00913312
p_int: 0.99965556
p_ni: 0.00034444
Data Source: BioPlex
FTH1
Tbio
Novelty: 0.00088724
p_int: 0.999200938
p_ni: 0.000799062
Data Source: BioPlex
TEFM
Tbio
Novelty: 0.13341034
p_int: 0.998729765
p_ni: 0.001270172
p_wrong: 6.3e-8
Data Source: BioPlex
DTL
Tbio
Novelty: 0.01976973
p_int: 0.99845333
p_ni: 0.00154667
Data Source: BioPlex
TXNDC15
Tbio
Novelty: 0.0004225
p_int: 0.99762375
p_ni: 0.00237625
Data Source: BioPlex
ZSCAN12
Tdark
Family: TF
Novelty: 0.40909091
p_int: 0.997363788
p_ni: 0.002636212
Data Source: BioPlex
Publication Statistics
PubMed Score  196.20

PubMed score by year
PubTator Score  167.06

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNPTLGLAIFLAVLLTVKGLLKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGR
1-70
NIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFI
70-140
DQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFF
140-210
RARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKL
210-280
KHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVG
280-350
EAVHKAELKMDERGTEGAAGTGAQTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGK
350-414
MNPTLGLAIFLAVLLTVKGLLKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGAAGTGAQTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGK