You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
MAPKAPK5
MAP kinase-activated protein kinase 5

Protein Summary
Description
Tumor suppressor serine/threonine-protein kinase involved in mTORC1 signaling and post-transcriptional regulation. Phosphorylates FOXO3, ERK3/MAPK6, ERK4/MAPK4, HSP27/HSPB1, p53/TP53 and RHEB. Acts as a tumor suppressor by mediating Ras-induced senescence and phosphorylating p53/TP53. Involved in post-transcriptional regulation of MYC by mediating phosphorylation of FOXO3: phosphorylation of FOXO3 leads to promote nuclear localization of FOXO3, enabling expression of miR-34b and miR-34c, 2 post-transcriptional regulators of MYC that bind to the 3'UTR of MYC transcript and prevent MYC translation. Acts as a negative regulator of mTORC1 signaling by mediating phosphorylation and inhibition of RHEB. Part of the atypical MAPK signaling via its interaction with ERK3/MAPK6 or ERK4/MAPK4: the precise role of the complex formed with ERK3/MAPK6 or ERK4/MAPK4 is still unclear, but the complex follows a complex set of phosphorylation events: upon interaction with atypical MAPK (ERK3/MAPK6 or ERK4 ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000550735
  • ENSP00000449667
  • ENSG00000089022
  • ENST00000551404
  • ENSP00000449381

Symbol
  • PRAK
  • MK5
  • MK-5
  • PRAK
  • MAPKAP-K5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.99
histone modification site profile
0.9
transcription factor binding site profile
0.83
kinase perturbation
0.81
kinase
0.8


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 83   (req: < 5)
Gene RIFs: 15   (req: <= 3)
Antibodies: 547   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 83   (req: >= 5)
Gene RIFs: 15   (req: > 3)
Antibodies: 547   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 19
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 5
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (93)
Cellular Senescence (R-HSA-2559583)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 13
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cellular Senescence
Reactome
Cellular responses to external stimuli
Reactome
Cellular responses to stress
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Name
Explore in Pharos
Explore in Source
Cellular Senescence
Cellular responses to external stimuli
Cellular responses to stress
Gene expression (Transcription)
Generic Transcription Pathway
Gene Ontology Terms (23)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (71)
1 – 10 of 71
MAPK6
Tbio
Family: Kinase
Novelty: 0.01585877
p_int: 0.999999998
p_ni: 1e-9
p_wrong: 2e-9
Score: 0.978
Data Source: BioPlex,Reactome,STRINGDB
MAPK4
Tbio
Family: Kinase
Novelty: 0.04156197
p_int: 0.999999428
p_ni: 5.69e-7
p_wrong: 4e-9
Score: 0.967
Data Source: BioPlex,Reactome,STRINGDB
ZNF577
Tdark
Family: TF
Novelty: 1.54411765
p_int: 0.999611145
p_ni: 0.000388854
p_wrong: 1e-9
Data Source: BioPlex
TP53
Tchem
Family: TF
Novelty: 0.00002203
Score: 0.99
Data Source: Reactome,STRINGDB
HSPB1
Tchem
Novelty: 0.00095687
Score: 0.984
Data Source: Reactome,STRINGDB
MAPK11
Tchem
Family: Kinase
Novelty: 0.00860226
Score: 0.968
Data Source: Reactome,STRINGDB
MAPK14
Tchem
Family: Kinase
Novelty: 0.00018655
Score: 0.968
Data Source: Reactome,STRINGDB
MYC
Tbio
Family: TF
Novelty: 0.000073
Score: 0.952
Data Source: STRINGDB
MAPK12
Tchem
Family: Kinase
Novelty: 0.01020422
Score: 0.938
Data Source: STRINGDB
MAPK13
Tchem
Family: Kinase
Novelty: 0.00235189
Score: 0.927
Data Source: STRINGDB
Publication Statistics
PubMed Score  83.00

PubMed score by year
PubTator Score  48.08

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MSEESDMDKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKARNEVRLHMMCA
1-70
THPNIVQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHFTEKQASQVTKQIALALRHCH
70-140
LLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKIDQGDLMTPQFTPYYVAPQVLEAQRRHQKEKSGIIP
140-210
TSPTPYTYNKSCDLWSLGVIIYVMLCGYPPFYSKHHSRTIPKDMRRKIMTGSFEFPEEEWSQISEMAKDV
210-280
VRKLLKVKPEERLTIEGVLDHPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLK
280-350
PLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGKGENEDEKLNEVMQ
350-420
EAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ
420-473
MSEESDMDKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKARNEVRLHMMCATHPNIVQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHFTEKQASQVTKQIALALRHCHLLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKIDQGDLMTPQFTPYYVAPQVLEAQRRHQKEKSGIIPTSPTPYTYNKSCDLWSLGVIIYVMLCGYPPFYSKHHSRTIPKDMRRKIMTGSFEFPEEEWSQISEMAKDVVRKLLKVKPEERLTIEGVLDHPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLKPLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGKGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ