You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SLC41A1
Solute carrier family 41 member 1

IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 103.77   (req: < 5)
Gene RIFs: 16   (req: <= 3)
Antibodies: 38   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 103.77   (req: >= 5)
Gene RIFs: 16   (req: > 3)
Antibodies: 38   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (4)
Metal ion SLC transporters (R-HSA-425410)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metal ion SLC transporters
Reactome
SLC-mediated transmembrane transport
Reactome
Transport of bile salts and organic acids, metal ions and amine compounds
Reactome
Transport of small molecules
Name
Explore in Pharos
Explore in Source
Metal ion SLC transporters
SLC-mediated transmembrane transport
Transport of bile salts and organic acids, metal ions and amine compounds
Transport of small molecules
Gene Ontology Terms (13)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
ParkinsonsUK-UCL
Inferred from Direct Assay (IDA)
ParkinsonsUK-UCL
Inferred from Mutant Phenotype (IMP)
ParkinsonsUK-UCL
Inferred from Sequence or structural Similarity (ISS)
ParkinsonsUK-UCL
Protein-Protein Interactions (33)
1 – 10 of 33
LYPD3
Tbio
Novelty: 0.0363726
p_int: 0.999998569
p_ni: 3.49e-7
p_wrong: 0.000001082
Score: 0.188
Data Source: BioPlex,STRINGDB
TNFRSF10C
Tbio
Novelty: 0.00061543
p_int: 0.999667735
p_ni: 0.000001687
p_wrong: 0.000330579
Data Source: BioPlex
NUCKS1
Tbio
Family: Enzyme
Novelty: 0.03371723
Score: 0.8
Data Source: STRINGDB
PM20D1
Tdark
Family: Enzyme
Novelty: 0.16751978
Score: 0.8
Data Source: STRINGDB
TRPM6
Tchem
Family: Kinase
Novelty: 0.00513865
Score: 0.759
Data Source: STRINGDB
RAB29
Tchem
Family: Enzyme
Novelty: 0.06535163
Score: 0.757
Data Source: STRINGDB
MAGT1
Tbio
Novelty: 0.02562036
Score: 0.74
Data Source: STRINGDB
MRS2
Tbio
Novelty: 0.00265329
Score: 0.736
Data Source: STRINGDB
TRPM7
Tchem
Family: IC
Novelty: 0.00264253
Score: 0.733
Data Source: STRINGDB
CNNM2
Tbio
Novelty: 0.04829521
Score: 0.708
Data Source: STRINGDB
Publication Statistics
PubMed Score  103.77

PubMed score by year
PubTator Score  39.98

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSSKPEPKDVHQLNGTGPSASPCSSDGPGREPLAGTSEFLGPDGAGVEVVIESRANAKGVREEDALLENG
1-70
SQSNESDDVSTDRGPAPPSPLKETSFSIGLQVLFPFLLAGFGTVAAGMVLDIVQHWEVFQKVTEVFILVP
70-140
ALLGLKGNLEMTLASRLSTAANIGHMDTPKELWRMITGNMALIQVQATVVGFLASIAAVVFGWIPDGHFS
140-210
IPHAFLLCASSVATAFIASLVLGMIMIGVIIGSRKIGINPDNVATPIAASLGDLITLALLSGISWGLYLE
210-280
LNHWRYIYPLVCAFFVALLPVWVVLARRSPATREVLYSGWEPVIIAMAISSVGGLILDKTVSDPNFAGMA
280-350
VFTPVINGVGGNLVAVQASRISTFLHMNGMPGENSEQAPRRCPSPCTTFFSPDVNSRSARVLFLLVVPGH
350-420
LVFLYTISCMQGGHTTLTLIFIIFYMTAALLQVLILLYIADWMVHWMWGRGLDPDNFSIPYLTALGDLLG
420-490
TGLLALSFHVLWLIGDRDTDVGD
490-513
MSSKPEPKDVHQLNGTGPSASPCSSDGPGREPLAGTSEFLGPDGAGVEVVIESRANAKGVREEDALLENGSQSNESDDVSTDRGPAPPSPLKETSFSIGLQVLFPFLLAGFGTVAAGMVLDIVQHWEVFQKVTEVFILVPALLGLKGNLEMTLASRLSTAANIGHMDTPKELWRMITGNMALIQVQATVVGFLASIAAVVFGWIPDGHFSIPHAFLLCASSVATAFIASLVLGMIMIGVIIGSRKIGINPDNVATPIAASLGDLITLALLSGISWGLYLELNHWRYIYPLVCAFFVALLPVWVVLARRSPATREVLYSGWEPVIIAMAISSVGGLILDKTVSDPNFAGMAVFTPVINGVGGNLVAVQASRISTFLHMNGMPGENSEQAPRRCPSPCTTFFSPDVNSRSARVLFLLVVPGHLVFLYTISCMQGGHTTLTLIFIIFYMTAALLQVLILLYIADWMVHWMWGRGLDPDNFSIPYLTALGDLLGTGLLALSFHVLWLIGDRDTDVGD